Conserved Protein Domain Family
CitA

?
COG3290: CitA 
Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms]
Statistics
?
PSSM-Id: 225827
View PSSM: COG3290
Aligned: 20 rows
Threshold Bit Score: 320.005
Threshold Setting Gi: 16077342
Created: 7-Oct-2002
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

COG3290 is classified as a model that may span more than one domain.
COG3290 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640810  10 HTKVCQTLSFQQRVGALLVAMVVIQLSLVAGFFHQTLSETLQDQISTKALIQAREIATDPNLIVLIQQNRL--------- 80
gi 21362444   1 MKRRLFPLTFSAKMMGFIALLIIAMFVLLGVFLNEQYARTLEEQMGERALSVAQAVALIPELREAFSAERPd-------- 72
gi 21362406   1 MVKKRFHFSLQTKIMGLIAALLVFVIGVLTITLAVQHTQGERRQAEQLAVQTARTISYMPPVKELIERKDGh-------- 72
gi 19551318  10 NFKEVDIIRFATRILVIQVATVALVVAICTGIFAVLMMDQMKTEAEHTALSIGRSVASNPQIREEVALDTQtganpsaee 89
gi 15829912   9 QFAFFQRLAFPLRIFLLILVFSIFVIAALAQYFTASFEDYLTLHVRDMAMNQAKIIASNDSVISEVKTRDY--------- 79
gi 15675090   1 ---MKKPLRLWASLSLILVSMIVVTTSLFYGIMLHDTHQSIKNQETHLLTSTGKMLASHQAIKELLLNNQPn-------- 69
gi 16763443   6 ITRWFARHSFQNRIFLLILFTSTIVMLAITWYLTDITKERLHYQVGQRALIQAMQISAMPELVEAVEAHDL--------- 76
gi 16764002   9 LFPFFRQLAFPLRIFLLILVVSVFIVAALAQYLSASFEDYLASHVRDMAMNQAKIIASNDSIIAAVKNRDY--------- 79
gi 15800334   9 QFAFFQRLAFPLRIFLLILVFSIFVIAALAQYFTASFEDYLTLHVRDMAMNQAKIIASNDSVISEVKTRDY--------- 79
gi 2500761    9 QFAFFQRLAFPLRIFLLILVFSIFVIAALAQYFTASFEDYLTLHVRDMAMNQAKIIASNDSVISAVKTRDY--------- 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640810  81 ---AEVQAKIDRLQRISDANFIVIGDANG-IRIAHPDEQKIGLPMQGGDsRRALKEGEYYTSTQKGSLGWAIRGKAAIVA 156
gi 21362444  73 ---EIIQPIAESIRVETGAEFIVVGNTDL-IRYAHPLPERIGQRMVGGDnERALVHGESYVSKAVGSLGPSIRGKVPVFD 148
gi 21362406  73 --aAQTQEVIEQMKEQTGAFAIYVLNEKGdIRSAS--G-KSGLKKLERS--REILFGGSHVSETKADGRRVIRGSAPIIK 145
gi 19551318  90 ladGDIQAVAQAANERTGALFVVITDGLG-IRLSHPDEERLGEQVSTSF--EAAMRGEETMAWETGTLGASARAKVPIFA 166
gi 15829912  80 ---KRLATIANKLQRDTDFDYVVIGDRHS-IRLYHPNPEKIGYPMQFTK-QGALEKGESYFITGKGSMGMAMRAKTPIFD 154
gi 15675090  70 ---AKTTAYTNSIASIYNLDYVVVMNMKG-IRLTHPNPKNIGKPFQGGD-EEAVLAGKKVISTAKGTLGKSLRYLVPVFD 144
gi 16763443  77 ---SRIKALIDPMRSFSDATYITVGNEKG-QRLYHVNPDEIGKYMEGGDsDDALYNAKSYVSVRKGSLGSSLRGKSPIQD 152
gi 16764002  80 ---KRLAIIANKLQRGTDFDYVVIGDRHS-IRLYHPNPEKIGYPMQFTK-PGALERGESYFITGKGSIGMAMRAKTPIFD 154
gi 15800334  80 ---KRLATIANKLQRDTDFDYVVIGDRHS-IRLYHPNPEKIGYPMQFTK-QGALEKGESYFITGKGSMGMAMRAKTPIFD 154
gi 2500761   80 ---KRLATIANKLQRDTDFDYVVIGDRHS-IRLYHPNPEKIGYPMQFTK-QGALEKGESYFITGKGSMGMAMRAKTPIFD 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640810 157 PS---GEILGVVSVGYLLDNISSWLRVYSYPVIFTVLLLMLLSALGAWIFTRHIKQQMFNMEPEEIAMNLNLQQSILQSV 233
gi 21362444 149 DN---GKIIGIVSVGFLMEDIQQVIGERLIAMWQIVVVIMILGLMGTWLVANTVKKATLGLEPEEIGQQFQQKEAILQSI 225
gi 21362406 146 EQkgySQVIGSVSVDFLQTETEQSIKKHLRNLSVIAVLVLLLGFIGAAVLAKSIRKDTLGLEPHEIAALYRERNAMLFAI 225
gi 19551318 167 PDs--SVPVGEVSVGFERDSVYSRLPMFLAALALISVLGILIGVGVAMGMRRRWERVTLGLQPEELVTLVQNQTAVIDGI 244
gi 15829912 155 DD---GKVIGVVSIGYLVSKIDSWRAEFLLPMAGVFVVLLGILMLLSWFLAAHIRRQMMGMEPKQIARVVRQQEALFSSV 231
gi 15675090 145 GD----KQIGAIAVGIKLTTLNDVALTSKRNYTLSLLLCLLISLLVTSFISFRLKRQLHQLEPSEIYQLFEERNAMLDQI 220
gi 16763443 153 ST---GKVIGIVSVGYTLEQLESWLNLQISSLLFPMALLLLVLLYCARRFSLHIKKQMLNMEPQQLSQLLIQQSVLFESV 229
gi 16764002 155 NE---GNVIGVVSIGYLVSKIDSWRLDFLLPMAGVFVLLLVVLMLLSWFFAAHIRRQMLGMEPKQIARVVRQQEALFSSV 231
gi 15800334 155 DD---GKVIGVVSIGYLVSKIDSWRAEFLLPMAGVFVVLLGILMLLSWFLAAHIRRQMMGMEPKQIARVVRQQEALFSSV 231
gi 2500761  155 DD---GKVIGVVSIGYLVSKIDSWRAEFLLPMAGVFVVLLGILMLLSWFLAAHIRRQMMGMEPKQIARVVRQQEALFSSV 231
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640810 234 YEGIVAISLKGEILSVNAKALNILGIAHQPTHLIGRNVQEFITPtCFFMGASpfgklaQQNRVSQQDELISCNGETLVAN 313
gi 21362444 226 HEGVIAVNKEGKVTLFNQAAMKYVDPELDKEDVLGRHVTDLVK--HTRLPEV------LQVGKGQYDQELRIGDKQAVVN 297
gi 21362406 226 REGIIATNREGVVTMMNVSAAEMLKLPEP---VIHLPIDDVMP--GAGLMSV------LEKGEMLPNQEVSVNDQVFIIN 294
gi 19551318 245 DEGVLALSPNGTIGVHNEQAQSMIGAGPMS----GRTLKELGL--DLGLDGV--------VLHGQHPETVAHNGRILYLD 310
gi 15829912 232 YEGLIAVDPHGYITAINRNARKMLGLSSPGRQWLGKPIAEVVRPaDFFTEQI------DEKRQDVVANFN---GLSVIAN 302
gi 15675090 221 EAAVFVVDKAGILQLCNQAGQKLIARKCQLGKPTGNSFNYLFP----DFPKL--------SLQEGHEQLFRYGEEDYLLA 288
gi 16763443 230 FEGLIAIDSHHRITAINQTARRLLNLSQPESELIGYAIHHVVLPeAFFYDAP------QKNKKDEIVTFN---QMKVIAS 300
gi 16764002 232 YEGLIAVDPEGHITAINRNARKMLGLPSPGRQWLGKLIAEVVNPaDFFTCQI------AERRQDVMANFN---GLSVIAN 302
gi 15800334 232 YEGLIAVDPHGYITAINRNARKMLGLSSPGRQWLGKPIAEVVRPaDFFTEQI------DEKRQDVVANFN---GLSVIAN 302
gi 2500761  232 YEGLIAVDPHGYITAINRNARKMLGLSSPGRQWLGKPIVEVVRPaDFFTEQI------DEKRQDVVANFN---GLSVIAN 302
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640810 314 RVPINSGQQQIGWVVSFRRRNDFNTLTSQLTQIRQHNDNLRVMSHEFANRLSTIGGLIQIGAYDEAVKTIRRET-AEQQQ 392
gi 21362444 298 RVPIYYDHEIVGAVATFRDRNEIKKLSEELTNVKNYADALRAQTHEFSNKLNTISGFLQLGKIDEAVDFIQKER-KIQQE 376
gi 21362406 295 TKVMNQGGQAYGIVVSFREKTELKKLIDTLTEVRKYSEDLRAQTHEFSNKLYAILGLLELGEYDEAIDLIKEEY-AIQNE 373
gi 19551318 311 FHPVRRGDQDLGYVVTIRDRTDIIELSERLDSVRTMTHALRAQRHEFANRIHTATGLIDAGRVHDAAEFLGDISrNGGQS 390
gi 15829912 303 REAIRSGDDLLGAIISFRSKDEISTLNAQLTQIKQYVESLRTLRHEHLNWMSTLNGLLQMKEYDRVLAMVQGES-QAQQQ 381
gi 15675090 289 ISPICVKNDHRGHIIFMREAVKAIDTLDQLAYTTAYASALQAQTHKFMNQLHVIYGLVDIAYYDQLKIYLDSIL-EPENE 367
gi 16763443 301 RMAVIIDNQPQGWVISFRNKDDINTLSLQLSQVRQYADNLRAVQHEHRNLISTIAGLLFLKRYDNALALIQQQS-ESHQK 379
gi 16764002 303 REAIRSGEELLGAIISFRSKDEIATLNAQLTQIKQYVESLRTLRHEHLNWMSTLNGLLQMKEYDRVREMVQGES-QAQQQ 381
gi 15800334 303 REAIRSGDDLLGAIISFRSKDEISTLNAQLTQIKQYVESLRTLRHEHLNWMSTLNGLLQMKEYDRVLAMVQGES-QAQQQ 381
gi 2500761  303 REAIRSGDDLLGAIISFRSKDEISTLNAQLTQIKQYVESLRTLRHEHLNWMSTLNGLLQMKEYDRVLAMVQGES-QAQQQ 381
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640810 393 LIDFIAQTFHPKVIAGLLLGKYSRAKELGLCLEFDPLSHLHQEPQCMTSDELAAVLGNLLDNAFEATLKnPHSNKTISLL 472
gi 21362444 377 WIHFFIERVNDPTVSAVLLGKISQAQELGIDVDIDPSSQLLTPLQERQQELLVTMIGNLLENAFDALLAsGIENKKIYIS 456
gi 21362406 374 QHDLLFHNIHSQQVQAILLGKISKASEKKVKLVIDENSSLAPLPAHIGLSHLITIIGNLIDNAFEAVA--EQSVKEVLFF 451
gi 19551318 391 HPLIGSAHLNEAFLSSFLSTASISASEKGVSLRINSDTLILG--TVKDPEDVATILGNLINNAIDAAVA-GEAPRWIELT 467
gi 15829912 382 LIDSLREAFADRQVAGLLFGKVQRARELGLKMIIVPGSQLSQLPPGLDSTEFAAIVGNLLDNAFEASLRsDEGNKIVELF 461
gi 15675090 368 ILTSLSVLVKEPLLASFLIGEQEKYQELNVHLKIDVLSEIPHSATKNQLNNGLMIYRFIHTNLLTTLR----P-KSLVLS 442
gi 16763443 380 VLDFISHNFRDHHLAGLLIGKYYRAKELGLELIFDPSSFVEHLPSSLSHNEWISIVGNLLDNAYNATLLnREGSRQIECL 459
gi 16764002 382 LIDSLRGAFADRQVAGLLFGKVQRARELGLKMVIVPGSQLHQLPEGLDSTEFAAIVGNLLDNAFEASLRtQEGDKTIELF 461
gi 15800334 382 LIDSLREAFADRQVAGLLFGKVQRARELGLKMIIVPGSQLSQLPPGLDSTEFAAIVGNLLDNAFEASLRsDEGNKIVELF 461
gi 2500761  382 LIDSLREAFADRQVAGLLFGKVQRARELGLKMIIVPGSQLSQLPPGLDSTEFAAIVGNLLDNAFEASLRsDEGNKIVELF 461
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640810 473 LTDNGAELVIEVADNGIGISADIAQ--TLFLKGVSSKN--QEGHGIGLYLVHQFVTQAHGSILIDSA-EPQGTIFSIFIP 547
gi 21362444 457 FTDMGDDFIFEVEDNGPGIPPQLME--SIFEEGFSTKEg--THRGFGLALVKKAVHELGGAIFLEEG-ELGGACFVLTIP 531
gi 21362406 452 ITDMGHDIVIEVSDTGPGVPPEKIE--AVFERGYSSKG---MRRGYGLANVKDSVRELGGWIELANQ-KTGGAVFTVFIP 525
gi 19551318 468 LMDDADTLVISVADSGPGIPEGVDVfaTATQIGDSEDNerTHGHGIGLKLCRALARSHGGDVWVIDRgTEDGAVFGVKLP 547
gi 15829912 462 LSDEGDDVVIEVADQGCGVPESLRD--KIFEQGVSTRAdePGEHGIGLYLIASYVTRCGGVITLEDN-DPCGTLFSIYIP 538
gi 15675090 443 IQHDQNHLISHYTLTDNWIDLERVQ--PIFDLPYFQQL---LTDTNSQFHQHQTVTELQFSVTTPYV-GGQHERFNH--- 513
gi 16763443 460 INSEGNEVIIEVADQGCGIDENIRQ--HIFERGVTTHN--NGDHGIGLWLVHSYVKQANGDIIVDNN-NPFGTIFTLYIP 534
gi 16764002 462 LSDEGDEVVIEVADQGCGVPEALRE--KIFEQGVSTRTdePGEHGIGLYLIASYVGRCGGVITLEDN-DPCGTLFSLFLP 538
gi 15800334 462 LSDEGDDVVIEVADQGCGVPESLRD--KIFEQGVSTRAdePGEHGIGLYLIASYVTRCGGVITLEDN-DPCGTLFSIYIP 538
gi 2500761  462 LSDEGDDVVIEVADQGCGVPESLRD--KIFEQGVSTRAdePGEHGIGLYLIASYVTRCGGVITLEDN-DPCGTLFSIYIP 538

                ....*..
gi 15640810 548 NRPKTLA 554
gi 21362444 532 KHEAKEG 538
gi 21362406 526 KEKQRGN 532
gi 19551318 548 GVME--- 551
gi 15829912 539 KVKPNDS 545
gi 15675090     -------
gi 16763443 535 FTREE-- 539
gi 16764002 539 KVKKNDD 545
gi 15800334 539 KVKPNDS 545
gi 2500761  539 KVKPNDS 545
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap