NCBI CDD Logo
?
COG2101: SPT15 
TATA-box binding protein (TBP), component of TFIID and TFIIIB [Transcription]
Statistics
?
PSSM-Id: 225012
View PSSM: COG2101
Aligned: 28 rows
Threshold Bit Score: 120.57
Threshold Setting Gi: 16120010
Created: 7-Oct-2002
Updated: 16-Jan-2013
Structure
?
Aligned Rows:

COG2101 is classified as a model that may span more than one domain.
COG2101 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 135643    58 SATSGIVPTLQNIVATVTLGCRLDLK-TVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLAS 136
gi 6647869    1 --MQDYKIKIENVVASTQIGENIDLN-KISREIKDSEYKPKQFPGLVLRTKEPKAAALVFRSGKVVCTGSKSVEDARRAV 77
gi 20089077   1 ---MEPTITIENIVASTRLAEDFDLQkLLDTGLKGAVYNKNKFPGLVYRIENPKAAFLIFASGKVVCTGTKNVENSRIAL 77
gi 20089176   1 ---MESTITIENVVASTALATEFDLVkIMDSGLEGAEYNKTKFPGLVYRIDNPKAAFLIFTSGKVVCTGAKTINNAHKAI 77
gi 2833518    1 MKIMEPEIKIVNVVVSTKIGDNIDLE-EVAMILENAEYEPEQFPGLVCRLSVPKVALLIFRSGKVNCTGAKSKEEAEIAI 79
gi 20094275   1 -------MEIQNIVASVDLKGEVNLD-ECSVILQG-EYEPEQFPGLVYRLEDIGTVVLIFRSGKMVCTGAKNREQIYKSV 71
gi 6647868    1 --MTDVDIKIENIVASATLGKSIDLQ-TVAEALENVDFNREQFPGLVYKLKEPKTAALIFGSGKLVCTGAKSIEDSKRAI 77
gi 6647870    2 VDTSNVKLRIENIVASVDLFAQLDLE-KVLDICPNSKYNPEEFPGIICRFDDPKVALLIFSSGKLVVTGAKSIQDIERAV 80
gi 13542225   1 -MSEREKITIENIVASTSLAEHLDLS-RIALALDGSEYEPEQFPGLIYRLQDPKTAVLIFRSGKVNCTGAKNIEDVKRTI 78
gi 14423941   1 -MSEREKITIENIVASTSLAEHLDLS-RIALALDGSEYEPEQFPGLIYRLQEPKTAVLIFRSGKVNCTGAKNIEDVKRTI 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 135643   137 RKYARIIQK-IGFAAKFT-DFKIQNIVGSCDVKFPIRLEGLAFSHGTF-----SSYEPELFPGLIYRMVKPKIVLLIFVS 209
gi 6647869   78 KQIVKMLKEiGISVID-EpEVKVQNIVASADLGVDLNLNAIAIGLGLEn----IEYEPEQFPGLVYRLDNPRVVVLIFGS 152
gi 20089077  78 FNLANELNSiGYKGIYLKpEIHVQNVVASANLRTSLNLNAVLSAFGVEn----VEYEPEVFPGLVYKLADPRVVVLVFRT 153
gi 20089176  78 TNLANKLKDiGCDKINLEpEIHVQNIVASADLKTTLNLNTIAIAFGLEn----VEYEPEVFPGLIYRVEAPKVVVLVFSS 153
gi 2833518   80 KKIIKELKD-AGIDVIENpEIKIQNMVATADLGIEPNLDDIALMVEG------TEYEPEQFPGLVYRLDDPKVVVLIFGS 152
gi 20094275  72 ERVREDLEKkCGVKFHGEpEVEIQNIVASIDFHVPLDLDTIAEVLVGDedvegIEYEPEQFPGLVLRLREPKVAMLLFYS 151
gi 6647868   78 KLTVDMMRT-MDPDIPEEfEIKIQNIVASANLGKPLNLEAVALGLEN------TEYEPEQFPGLVYRLDDPKVVLLLFGS 150
gi 6647870   81 AKLIQKLKG-IGVKFKRApLIDVQNMVFSGDIGREFNLDNVALTLPN------CEYEPEQFPGVIYRVKEPRAVILLFSS 153
gi 13542225  79 KIIIDKLKA-ANIEVYDDpDIIVQNIVAVYDLESELNLTDIAMSLGLEn----VEYEPEQFPGLVYRVEEPRVVLLLFGS 153
gi 14423941  79 KIIIDKLKA-ADIEVYDDpQIIVQNIVAVYDLESELNLTDIAMSLGLEn----VEYEPEQFPGLVYRVEEPRVVLLLFGS 153
                       170       180       190
                ....*....|....*....|....*....|.
gi 135643   210 GKIVLTGAKQREEIYQAFEAIYPVLSEFRKM 240
gi 6647869  153 GKMVVTGGKSPEDARKAVERISEELRTLGLM 183
gi 20089077 154 GKLVITGGKCPEDCEEGLRIIKTQLDNLGLL 184
gi 20089176 154 GKLVITGGKCEEDCNGGLRIVRKEFDNLGLL 184
gi 2833518  153 GKVVITGLKSEEDAKRALKKILDTIKEVQEL 183
gi 20094275 152 GKAVCTGAKTEEEPEKAVKKIAEKIEKYGLK 182
gi 6647868  151 GKVVCTGAKSAEDAKLGVEKTKARLAELDLI 181
gi 6647870  154 GKIVCSGAKSEADAWEAVRKLLRELEKYGLI 184
gi 13542225 154 GKVVCTGAKEESEIEQAVIKVKKELQKVGLI 184
gi 14423941 154 GKVVCTGAKEESEIEQAVIKVKKELQKVGLI 184
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap