Conserved Protein Domain Family
RecC

?
COG1330: RecC 
Exonuclease V gamma subunit [Replication, recombination and repair]
Statistics
?
PSSM-Id: 224249
View PSSM: COG1330
Aligned: 18 rows
Threshold Bit Score: 862.076
Threshold Setting Gi: 15594979
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

COG1330 is classified as a model that may span more than one domain.
COG1330 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15599481   13 GFMIVHGNR-LDDLRDLAVS-WMRRYP--LA-PLESE-RVLVHSNGIAQWLKLALAEDPredgggggGIAAALEVQLPAQ 86
gi 15594979    1 -MYIYKTNK---VNKIYNK--IKELTQ--KDnIFKKEtLIIVKNDLLREEIKKTIAKLN--------GISYNLNIKKNAA 64
gi 11132304    1 MFTIYKSNS-LNTLLLKAYH-IIEEKP--FSnIFEKE-IFIYDNKVLFQYLNIFIAEKK--------GISANFKFYHPND 67
gi 15618647    1 MNATKHCRAsFSNSPRHLLAqLAEDITstHQkPFTKR-WILVANATTGHWIKNQLVHVL-----------SDHIFMGSTI 68
gi 15840032    2 ALHLHRAER-TDLLADGLG--ALLADP--QPdPFAQE-LVLVAARGVERWLSQRLSLVL--------GCGPGRADGVCAG 67
gi 15794857    1 MFYLYQSNR-LETLAALFAR-IQKVKP--LKsALQPE-QIIVQSQGMRRYLNTCLARDL--------GVAANLSFSLPAG 67
gi 15677567    1 MFYLYQSNR-LETLAALFAR-IQKVKP--LKsALQPE-QIIVQSQGMRRYLNTCLARDL--------GVAANLSFSLPAG 67
gi 15602826    1 MFTIYYSND-LDVQKNILLT-LMQDT---LDdPFQSD-VILVQSPGMAQWLQWKIAEQQ--------GISSNIKFPMPAS 66
gi 8134454     2 ALHLHRAER-TDLLADGLG--ALLADP--QPdPFAQE-LVLVAARGVERWLSQRLSLVL--------GCGPGRADGVCAG 67
gi 15837024    9 DFRLYHSNA-LDVLAGLLAEtLRSPVP--GQsLLVPD-IILIPQAAMRRWLQATLATTH--------GVVANLEFLTPGE 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15599481   87 FLWQAYRAVLGRESi-pEVSELDKAPLTWRLMRLLPG-----LLERPEFRTLQRFLADDADLRK---RHQLAERLADLFD 157
gi 15594979   65 KSIYEISFKNPNIK------KYIEENTFSFYLETEKF-----ILYNILKTEKLKYIKDFKSTKN---RYFFASKIIDLFH 130
gi 11132304   68 FIWKLFKIILSKKE---LKNIFTHSMIIWEIIKILDN---------KKFFENCSKKKDMIKKFK------FSFLMASIFK 129
gi 15618647   69 FTAS--DSIVKHLF-----LGSGCSQPNIPDYLTLPL-----LINNILEEISKASKFENGREFLsppTYETTKKLAAAFK 136
gi 15840032   68 IAFRNPQSLIAEITgtlDDDPWSPEALAWPLLAVIDAsldepWCRTLASHLGHFATTDAEAELRrgrRYSVARRLAGLFA 147
gi 15794857   68 LTWKLMKKLIPGIP---ELSPFAPEVMRWRLLDLFRSe---aFRNTAEFEDVRNVLQDYLGSGEs-aDYQLAGQLADIFD 140
gi 15677567   68 LTWKLMKKLIPGIP---ELSPFAPEVMRWRLLDLFRSe---aFRNTAEFEDVRNVLQDYLGSGEs-aDYQLAGQLADIFD 140
gi 15602826   67 FIWQQYVDNLPNTE---EQSQFNKASMTWRLMRLIPE-----HLEQVEFQSLRHYLSSSHQTEQq-kLYQLAYQIADLFD 137
gi 8134454    68 IAFRNPQSLIAEITgtlDDDPWSPEALAWPLLAVIDAsldepWCRTLASHLGHFATTDAEAELRrgrRYSVARRLAGLFA 147
gi 15837024   77 FVARALDANLGAVP-----NALDTAVLHWRLYAALCDp---aLLTQPALAELHAYLADGDLFKP----WTLAEALSAAFE 144
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15599481  158 QYQVYRGDWLDDWSQGrdqlr----------tangQARPLGADERWQAELWRALLADVGADSLAr---SRSGVHRRFIEA 224
gi 15594979  131 HYYSKFSKLIETWEDN-------------------GFLFQEENLKPYENMQKELFKKLFE-KQK----NILNLHKKIIQE 186
gi 11132304  130 KYILYRPEWINQWEIEk------------------NISIFDKNEQWQIKLWMEIIHNTKKINQSs--dHFANLFYNIQKI 189
gi 15618647  137 QFHTFSQR------PT-------------------------KNASHYQELFQILES------------HFSSYEEMFTTI 173
gi 15840032  148 SYARQRPGLLAAWLDG-------------------DLGELPGDLAWQPPLWRALV--TTVGADP----PHVRHDKTIARL 202
gi 15794857  141 QYLVYRPQWIDAWQQG-------------------RRLGLGDDEIWQSKLWRYLD--DGRQSAP----HRVALWEKLLAA 195
gi 15677567  141 QYLVYRPQWIDAWQQG-------------------RRLGLGDDEIWQSKLWRYLD--DGRQSAP----HRVALWEKLLES 195
gi 15602826  138 QYLVYRPEWIACWERGdeatmmaqlerklkdtrlpIGNAFSQDVKWQAILWRALVADILAESGQtvplHRAYLQTQFLQF 217
gi 8134454   148 SYARQRPGLLAAWLDG-------------------DLGELPGDLAWQPPLWRALV--TTVGADP----PHVRHDKTIARL 202
gi 15837024  145 KYQAWRCDWLLRWEAG-----------------------A-DPDDPQAILWRHSVNGATHRARR-----IHDYLNRYGSG 195
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15599481  225 LRSAsAAPRALPRRVVVFGISSMPAQTLEALAALARFSQVLLCVHNPCRHHWADIVADKDLLRHEYRRQQrr--aGv-Pa 301
gi 15594979  187 KPTK-KIEIEIKKIIFIGNNREIEKKILNSLEKIFD-FEVHVLIFEDLLNYESTLVK----------------------- 241
gi 11132304  190 IKEKkIKKKYLPKRFFIISSFSMNPSYIKIFQNISIYTDIYFLYITPFKKNIFNFIQDNKIFTDIKIE------------ 257
gi 15618647  174 LNN---RTQEEDCSLHIFGYAHLPKHLAEFFINLSTYFPVYFYCFSPCREYFGDLLSDRAIDFFWNQLPDs-------P- 242
gi 15840032  203 RDG----PADLPARLSLFGHTRLACTDVQLLDALAVHHDLHLWLPHPSDELWRALAGFQGADGLLPRR-------Q---- 267
gi 15794857  196 LD-----KDKLPERYFVFGISTMAPMYLQLLHKLSEHCDVFVFALNPSGMYWGNVI---EAAQILKGG-------G---- 256
gi 15677567  196 LS-----SDKLPERYFVFGISTMAPMYLQLLHKLSEHCDVFVFALNPSGMYWGNVI---EAAQILKGG-------G---- 256
gi 15602826  218 LQT--QHPVNLPPRLFIFGISALPKGYLEIFYAMSQYCEVHLFFTNGCREYWGDLIDPRFMQRLSQMQRTgyhtaLpiPv 295
gi 8134454   203 RDG----PADLPARLSLFGHTRLACTDVQLLDALAVHHDLHLWLPHPSDELWRALAGFQGADGLLPRR-------Q---- 267
gi 15837024  196 TEHP---PQGLPARLFIFATLNISPDVLRVLATQAQVGTLHFYLPTPTKEYWGDAQP---FTQRLHQP------------ 257
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15599481  302 --DLDEDRQHQ-----Ha---QPLLAAWGKQGRDYINLLDSYDDPDsyrnlfgevnggRIDLFSEET------------P 359
gi 15594979  242 ----------------------ELLLTKTKINPIKYQALEKVDIE--------------L--FK---------------G 268
gi 11132304  258 ---KKNILNDS------------LITLWGQYEEIYYFYILKSKKNK------------VINCFKKNK------------N 298
gi 15618647  243 --IKNAWEHYVls------drQALLANLAHKSQSSQNFFLDREID-------------YQEMFLPSK------------H 289
gi 15840032  268 --DTS--RRAA-----Q----HPLLETLG---RDVRELQRALPAAR------------ATDEFLGATt----------kP 309
gi 15794857  257 --DPD--LTQA-----G----HPLLASLGKQGRDFFDFLNEMEIEG------------ETPVFE--Eg----------gR 299
gi 15677567  257 --DPD--LTQA-----G----HPLLASLGKQGRDFFDFLNEMEIEG------------ETPVFE--Eg----------gR 299
gi 15602826  296 fhHTDNARFESsydheHlfegHPLLSSWGKLGRDFLYLLTELEQLEgv---------rSIDAYTELT------------S 354
gi 8134454   268 --DTS--RRAA-----Q----HPLLETLG---RDVRELQRALPAAR------------ATDEFLGATt----------kP 309
gi 15837024  258 ---TDCVTQTGe---------NRLLHAWGAAGRDFMTVLGSYEVVHps---------gEITAYDDPEqrlgttldegglR 316
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15599481  360 HGLLGQLQDDILELRplAETREHWppVAPRSDASIRFHVAHSAQREVEILHDQLLARFNAD--------PSLKPRDVIVM 431
gi 15594979  269 ENFLTSIKNNIIAKT-----------PISTLDDSFKIIEAKNQKREVEILTNQIVHSMQKNn-------LKLSDIAITCL 330
gi 11132304  299 KSLLSQIKNNFFNDS--EFTRKKR--FLEISDHSISINICFNKKNEIEVLYEKLLIFLNEN--------SSIKPGDIVVT 366
gi 15618647  290 DSSLGVIQNSILDLK--PTSPQ----DFSQTKQTICIYRALNIPREVQEVFCKVTELLHRG----------VSPEEIFIL 353
gi 15840032  310 DTLLGWLQADIAGN---APRPAGR--SLSDADRSVQVHACHGPARQIDVLREVLLGLLEDD--------PTLQPRDIVVM 376
gi 15794857  300 DTLLHALQTDIQNLK--MPSENVG--SVGTDDGSIRIVSAHSPLRELQILKDKLLKILHEH--------PDWQPHDIAVL 367
gi 15677567  300 DTLLHALQTDIQNLK--MPSEMAG--SVNTGDGSIRIVSAHSPLRELQILKDKLLKILHEH--------PDWQPHDIAVL 367
gi 15602826  355 QHLLSQVQARILHLE--GKQGl----NLAENDRSLTFHSCHSPMREVEVLHDYLLHLFQQD--------STLTPKDIVVM 420
gi 8134454   310 DTLLGWLQADIAGN---APRPAGR--SLSDADRSVQVHACHGPARQIDVLREVLLGLLEDD--------PTLQPRDIVVM 376
gi 15837024  317 DSLLQRMHADLFHNR--SAPVPAPlpAPRLEDPSLQFHACHTRLRELQVLHDRLRALLEPNspegqrfnPPLQPREIAVL 394
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15599481  432 VPDINAYAPHIEAVFGQVPRDd----qRFIPYTLADQGQRGREPLLIALEHLLKLPDSRFAVSEILDLLDVPALRRRFGV 507
gi 15594979  331 QEKFNEYLPYIEECLNKYEIEy----sVLCYNNLSRGESIIALKRLMDLFVSKNGTISNFSRKEVFDLLSNNKVMKKFNI 406
gi 11132304  367 SFSLDTYISSINLIFQSIDNK------KTIPFFIAKKSSKTTEIMLWSFKKILNLSNSRFENEEILELLDVPEIAEKFNF 440
gi 15618647  354 SSHIESYKVHLNAIFNP-----------HVPIYFTDEVDPRAEDLRNKILLLSSILQTQGDLHYILQLLTHPQLQQPIDQ 422
gi 15840032  377 CPDIDTYAPLIVAGFGLGEVAgdchpaHRLRVRLADRALTQTNPLLSVAAELLTIAETRATASQLLNLAQAAPVRAKFGF 456
gi 15794857  368 TPNIESYTPFIEAVFGQAQPGa-----QALPYSVSDVKISRRQPLFHALSCLFDLLESRFEVDKVLVLLETAPVLRHFGL 442
gi 15677567  368 TPNIESYTPFIEAVFGQAQPGa-----QALPYSVSDVKISRRQPLFHALSCLFDLLESRFEVDKVLVLLETAPVLRRFGL 442
gi 15602826  421 VADIDKYTPYIQAVFGQYNQVaq----rQIPFSISDNRLSENDVLIASFIHLLALKESQFSAEDILALLDIPAIRNRFQI 496
gi 8134454   377 CPDIDTYAPLIVAGFGLGEVAgdchpaHRLRVRLADRALTQTNPLLSVAAELLTIAETRATASQLLNLAQAAPVRAKFGF 456
gi 15837024  395 APDIDLYIPYLEAVFGGHAHS------DPLPYTLADASPLIDEPLAEVFLRLLDLPLSRFGLHEILDLLAILPMATLAGF 468
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15599481  508 DEADLATLHRWIEGAGVRWGLDAAQRERLGLPAGLEgNSWRFGLRRMLLGYAVGEGA--ALQG-IQPYDEVGGLDAALAG 584
gi 15594979  407 STSELNYLIEFSDTMNISFGANKTHKENLNYDQNFL-NSWEDGFNRFLMSEIFDEKY--EEET---QKESTRFQDQESIM 480
gi 11132304  441 SEEEIKILYHWIEETNIRWGINEKHKNYLLFPKNKQ-NTWFYGIEKLLLSYAMNDTEk-IWNG-VLSCSFINGSRSELIG 517
gi 15618647  423 NKVPYLI-K----KLSSEWGKISSKDR-----ASGQ-QMKALG-DLILEEYPFHQEG-----G---RVSQV--EVWETTV 480
gi 15840032  457 ADDDLDTITTWVRESNIRWGFDPTHRRRYGLDTVVH-NTWRLGLDRILTGVAMSEDSq-AWLDtALPLDDVGSNRVELAG 534
gi 15794857  443 TEDDLPLLHDMVADLNVRWGLDGEMRG--GTDQLF---TWKQAVERMILGWMLPEGGnpMWQGvSAWYADV--NQTALFG 515
gi 15677567  443 TEDDLPLLHDMVADLNVHWGLDGEMRG--GTDQLF---TWKQAVERMILGWMLPKGGnpMWQDvSAWYADV--NQTAMFG 515
gi 15602826  497 ELMELEQIRHWVAHAGIRFGVEKEQGK----QEKNT-NSWQAGLERMLLGYAMREENg-IWQG-NLGFDPCYGLQGQLAG 569
gi 8134454   457 ADDDLDTITTWVRESNIRWGFDPTHRRRYGLDTVVH-NTWRFGLDRILTGVAMSEDSq-AWLDtALPLDDVGSNRVELAG 534
gi 15837024  469 DTQTLESLRSWLTAAGARWGLDAAHRAEHQAPADDA-YTWSFALDRLLLGHASGADA--DIAG-VAAWPDLEGSMLTALD 544
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15599481  585 PLAVLLERLEVAYAELAEPAT-PAQWGERLQALLTVFFEAh---DERDELLLTQLLQLLER-WQEHCACAAFAEPLPISV 659
gi 15594979  481 KLITIVKSLYEDINYFKNKAYkVYEWAEIIEIFIQKYIDLedfnTTDEYLQNKIKSFKNFPkDLNDNLYKNYLKEINEIK 560
gi 11132304  518 KLISFIKILEKWQKKLSKLQY-LTYWRSLYSDLVSDFFQN----NTKIEKSIQIIQKKWIE-IIDDSLSSNYLKKISINI 591
gi 15618647  481 PLIYFIQERINLYLSSSQHSY-EDLFQNVFSCLEKIFVLS-----PEETSFITTLRNSLFPtFATSSCSLLFFTDFCLDF 554
gi 15840032  535 RLAEFVERLHHVVGGLSGARP-LVAWLDALATGIDLLTAC----NDGWQRAQVQREFADVL-ARAGSRAAPLL-RLPDVR 607
gi 15794857  516 RFAAFLETLTDIVRIWRQPAT-VDEWVARCRDLLETLFQV----EGDDQKAVQSLENEWVK-WQAETELAQFSGQLPLHT 589
gi 15677567  516 RFAAFLETLTDIVRIWRQPAT-VGEWVARCRDLLETLFQA----EADDQKSVQNLENEWVK-WQAETELAQFSGQLPPHT 589
gi 15602826  570 RLAEFIARLSAWYQFLQTPQP-IEKWQQHLLTLLTDFFAE----DETNITTLRYIQETIVQ-MVTDIQQTHFDQPLSSEV 643
gi 8134454   535 RLAEFVERLHHVVGGLSGARP-LVAWLDALATGIDLLTAC----NDGWQRAQVQREFADVL-ARAGSRAAPLL-RLPDVR 607
gi 15837024  545 TLIRLLRVLANTRQRLSEALL-PTQWRERLLSLLDALLPDiptaPSGIQRPLERLRRLIDT-FATDATRAGVALPVPAEV 622
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15599481  660 IREAWLGGLDQGGLNQRFLAGAVSFCTLMPMRAIPFRLVCLLGMNDGDYPRQQSPLDF-----DLMRNDYRPGDRSRRED 734
gi 15594979  561 IEFYLFKIMLEESLEKEKYGVMYKKNGILIANYKEIEYLQKKEIHFLGFQKFNSKINY-----DNMNLLNEYYEHENTEK 635
gi 11132304  592 LKKIFFYKYYDNNHEI-FLPGVVNFCYPDSVCYIPFKVICMIGTDHTSIPKTNYLDNF-----NLLKKYPLIGDINLYQK 665
gi 15618647  555 LLHFHKPSPLYDKPGP--YIGSLSSLSLIPKG-----YVFILGANKTTSSDIFDLLNR-----TTTHEELAFS--STEDE 620
gi 15840032  608 ALLDAQ-LAGRPTRAN-FRTGTLTVCTMVPMRSVPHRVVCLVGLDDGVFPRLSHPDGD-----DVLAREPMTGERDIRSE 680
gi 15794857  590 VIRHIRRFLDSESEAG-FLRGGITFCSMVPMRSLPFKVICLLGLNDGDFPRNTKAAVF-----DLIAKHPAKGDRARRDD 663
gi 15677567  590 VIRHIRRFLDSESEAG-FLRGGITFCSMVPMRSLPFKVICLLGLNDGDFPRNTKAAVF-----DLIAKHPAKGDRARRDD 663
gi 15602826  644 VSDVLSALLEDDPNSMKFLAGKVNFCTLLPMRSIPFKVVCLLGMNEGDYPRQQTPNSF-----DLMQYDRRKADRFRRDD 718
gi 8134454   608 ALLDAQ-LAGRPTRAN-FRTGTLTVCTMVPMRSVPHRVVCLVGLDDGVFPRLSHPDGD-----DVLAREPMTGERDIRSE 680
gi 15837024  623 VRMHFAALLGDTDTRAPLLTGGISIGRMVPMRLLPFRVICLLGMNDGDFPRRDPAAGLnrltaELGTAQRRPGDRSRRDD 702
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15599481  735 DRYLLLEALLSAREQLYVSWVGRSIRDNGERPPSVLIGQLRDHLAagWRLDPDGDGE--------ALLRALTQEHPLQPF 806
gi 15594979  636 EEITALFNLIFATSEKFYLYCSFQDNLSPEINTSKTINKILEHIQ---KYEKNFQ-----------IEKHPNENHDPVYF 701
gi 11132304  666 YSYLFVQSLSCAEKYFYISYIGYSVKDESKVHPSILVDQLLNYIT--LNFCFIGDQNlsykenskKITKYLCKKHKKQFF 743
gi 15618647  621 ENFHFLQILVSTKHELHISYISSAA---QFNLPSPFLNHIKETLDl-PVETLPTQPYl------sAFFKNKACLHTSQEY 690
gi 15840032  681 DRQLLLDAIGAATQTLVITYTGADERTGQPRPPAVPLAELLDALD--QTTSAPVR-------------ERILVTHPLQPF 745
gi 15794857  664 DRYLFLEALISAREILYLSYIGRDIRKDEELAPSSLLGELIDTVA--AMTGTNSRQ----------LAQNWIEQHPLQAF 731
gi 15677567  664 DRYLFLEALISAREILYLSYIGRDIRKDEELAPSSLLGELIDTVA--AMAGIGSRQ----------LAQNLIEQHPLQAF 731
gi 15602826  719 DCYLFLEALLSAQEAFYVSFVGRSIVDNQSKPPSVLVSQLIDYLVd-KLSSAETQDW----------QARLIEQHPMTAF 787
gi 8134454   681 DRQLLLDAIGAATQTLVITYTGADERTGQPRPPAVPLAELLDALD--QTTSAPVR-------------ERILVTHPLQPF 745
gi 15837024  703 DCLLFLQLFSAAQDVFYVSYLGADPHDGSLREPSPLLTELLSTAV--TYHADPST-----------AAKTLLLRHSLQPF 769
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15599481  807 SRRYFHDApeqgvDgLFTYAREWREVHREDEIG--VPDAEAPLP-----PLELEGALGLRALAEFLANPVNAFFQQRLKV 879
gi 15594979  702 KDAKENYL-------IN-YDPEAYNIAKILQNS---KPIGFKQNk---iKLESPIKLNLYELKNALSNPYKHFYEKTLNV 767
gi 11132304  744 YETKNIES----------FIQDDIKNDFKHTEKn-ISHKNLLKK-------NTDNEINLKDLINFWKHPIRYFYNSHLKI 805
gi 15618647  691 NYSLAHAFys----kKALLPSLFIPTVKQVNLPqhLSLNEIIKG------IFSPLDLFLKTNYNLRISYPEHLKKQQKLF 760
gi 15840032  746 DRKNVTPGallgaK-PFTFDPAALAAAQAAAGKr-CPPTAFISGr---lPAPPAADVTLADLLDFFKDPVKGFFR-ALDY 819
gi 15794857  732 SRRYFQEGg---rS-DGIFGTRTDYAAALGQTPe-PPQPFFDQPv---eNAEPVAEIGQDEFIRFWRNPVKVWLQQQLAW 803
gi 15677567  732 SRRYFQEGg---rS-DGIFGTRTDYAAALGQTPe-PPQPFFDQPv---eNAEPVAEIGQDEFIRFWRNPVKVWLQQQLAW 803
gi 15602826  788 SPDNFRGEn-------GSFANQWLPLANIQKQEr----ADFVQPiaq-tvLAEDREIVLADLIAFIQHPVAFFFKRHLGV 855
gi 8134454   746 DRKNVTPGallgaK-PFTFDPAALAAAQAAAGKr-CPPTAFISGr---lPAPPAADVTLADLLDFFKDPVKGFFR-ALDY 819
gi 15837024  770 SPTAFGADg---dPrRFSYHPLWHAAAASIEGQr--HPLDPWCPrrlpaLPDPEPALPLHSLRRFFSAPAEQFLQQRLGL 844
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15599481  880 RFD---DEQLTGNDEEPFELDALDNWKLQFELTErmkrWVERDWDAEGlpvqlqaQVERl-RRQGRLPLAAFGEFSARHL 955
gi 15594979  768 KIQ---DIRLENEIKEKQEEQIFSVIEIIYRLIK---------NSTL---------------------LHEYIMGKKDDV 814
gi 11132304  806 KIR---QKKQKINTTETFLVNPLNSFKIKNKLLD----YIIHNKNITK--------LYQhyLLSGKLPYHFFGEIFWIKN 870
gi 15618647  761 PTK---HQIEDFWNECFVDKEHDLIPSISPHAEEl---FTYYREKTIL--------LRN--GLDKDPKHSPYTVTFSSSI 824
gi 15840032  820 TLP---WDVDTVEDSIPVQVDALAEWTVGERMLRdmlrGLHPDDAAHS-------EWRR---GT--LPPGRLGVRRAKEI 884
gi 15794857  804 SEPhigEAWEPAEPFEPQHADQIAETYIEARRE-----GRDFAQTAAR-------IGAE---SL--LPSGELGRLWQQNF 866
gi 15677567  804 SEPhigEAWEPAEPFEPQHADQIAEIYIEARCE-----GRDFAQTAAR-------IGAE---SL--LPSGELGRLWQQDF 866
gi 15602826  856 SFA---KQEERIEDSENFTLDGLMRYQINEQLLY-----CDEEKSAEV--------LAQl-KVKGMLPRGEFAQIFALQQ 918
gi 8134454   820 TLP---WDVDTVEDSIPVQVDALAEWTVGERMLRdmlrGLHPDDAAHS-------EWRR---GT--LPPGRLGVRRAKEI 884
gi 15837024  845 RLPe-pPQTTDECDPLWLPSHGLERHRLDTLIFAs---LLHEADDTLY-------PQLR---ARALLPSGPLGRQQLHER 910
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15599481  956 L-QPLPDLLWRYR-QEIERWPEAVEQQQELRhrhpsGLELEDWLGGLRRDASgrlarLQLLSGKLHEGRsfkwhsLVRHW 1033
gi 15594979  815 R-KAIEIIKNHIR-YEIQQGSIPFNIDQ--------KTTVNEILKKINKLKY--------NAAES-LKK------LSAMT 869
gi 11132304  871 I-KEMKLIANKVMqYRIEKEEKKINLNIE-------KYQIYGVLSEIQSTGL-----LRWKTSSIRYSD------RIALW 931
gi 15618647  825 FeERPYHESYLFPpLSLSFQGNPVQIHGTIH-----GVCNEGLYLCSIDPRDslkktTRTLGSLPETSS------EQKQL 893
gi 15840032  885 R-NRARDLAAAAL-AHRDGHGQAHDVDVDLGd----GRRLSGTVTPVFGGRT-----VSVTYSKLAPKH------VLPAW 947
gi 15794857  867 Q-TAAKQIDTAVL-NSPKLPPLSYAIPSd-------GQILKGSLGNLYRCGQ-----VFYAYGKPNAPQ------RIAFL 926
gi 15677567  867 Q-TAAKQIDTAVL-NSPKLPPLSYAIPSd-------GQILKGSLGNLYRCGQ-----VFYAYGKPNAPQ------RIAFL 926
gi 15602826  919 Q-EDIAALKTTVA-DYLKQEAHVVEVDLTIPsg-ygDIRLIGLLDQLYAQRR-----VMWRVGQIQEKH------LIENW 984
gi 8134454   885 R-NRARDLAAAAL-AHRDGHGQAHDVDVDLGd----GRRLSGTVTPVFGGRT-----VSVTYSKLAPKH------VLPAW 947
gi 15837024  911 I-EHLRPYAQAFAhWRGTAPPQSQYLEVMID-----GIRLHAHIQDLYPHGI-----ARLRLGPPNGPA------VLRHG 973
                       1130      1140      1150      1160      1170      1180      1190      1200
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15599481 1034 LQHLALQRL--GQPVSSVLVS---QTGTLE--IPPL-PSERASEYLDQLIDAWRQGMRQPLPLACRTAFAWLASGGAa-- 1103
gi 15594979  870 KSKIKFCKK---------------IKLNFQ--------NKNIEFELKKDIENVYKVENNYFYLN-FVKKDYCSIP----- 920
gi 11132304  932 LEHLIYSIL--GGCGKSKIIGy--KSQIWS--FSSL-NSHRAHSYLLEYIKGYIKGMKEPLFLT-KSGASWLDQVYDern 1003
gi 15618647  894 LERYVALAVlqMSQHLSSDSAl-iKLTSFNtkENHHpPFSDPEGYLRKVLEVYHLMSSQPIPLL--SPLCWKTLDD---- 966
gi 15840032  948 IGLVTLAAQepGREWSALCIGr--SKTRNHiaRRLFvPPPDPVAVLRELVLLYDAGRREPLPLPLKTSCAWAQARR---- 1021
gi 15794857  927 LEHLIFCAVmpSEAETRQTFIv--QSGETEilAEIAqDR--ALQLLSEWMAFFNIGQNRPLPFFAKTSLAAAEAFAQk-- 1000
gi 15677567  927 LEHLIFCAVmpSEAEMRQTFIv--QSGETEilAEIAqDR--ALQLLSEWMAFFNIGQNRPLPFFAKTSLATAEAFAQk-- 1000
gi 15602826  985 VYYLIQCAMlaQHEPPIYYGKngqATFQALcaSESLsVKEIALAQLQIYVESYLQGYQQMQMVPMKNIQRYLEAYGHte- 1063
gi 8134454   948 IGLVTLAAQepGREWSALCIGr--SKTRNHiaRRLFvPPPDPVAVLRELVLLYDAGRREPLPLPLKTSCAWAQARR---- 1021
gi 15837024  974 LDWLLASAA--GHPWPLVRFEdagVAGLGPh-LQPSlPSSQAQTALSLLLRLRTAGLRQPLPFAPYSAWEYYTQR----- 1045
                       1210      1220      1230      1240      1250      1260      1270
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 15599481 1104 -----EPE---KAMREARKRYEGGFGMGGEVDAsPALARVYPdf---drLLASGEFAHWAEQLYAPLLAALGRGAEE 1169
gi 15594979  921 -----------DKIKNEIDLYITGLLIKKEIQNfNSLTEVKI------------DLESLTAKNNYLLS--SQRNNN- 971
gi 11132304 1004 nciknDYYtkiKAYKKLLYTWKGDNYTEGEQED-YYLKKTIT-------ISNKKNIKKICESAEKWLIPILKNKG-- 1070
gi 15618647  967 -----EEKfhqAVLSAISEEAKNPSLPIFWQFHnRNIEEILN-----------HVGASERLKILSLFRGPCEAV--- 1024
gi 15840032 1022 -----DGQ---DPYPPARECWQTNRFRPGDDDA-PAHVRAWGprapfevLLGKPRAGEEVAGEETRLGALAARLWLP 1089
gi 15794857 1001 ----qDWE---AALKKAQTAYYGNKVSKGQKDY-TEVALVFGnas--qnPLEQPLFENLARLLADTLAAAEKREGAG 1067
gi 15677567 1001 ----qDWE---AALKKAQTAYHGSKVSKGQKDY-TEVALVFGnas--qnPLEQPLFENLVRLLADTLAAAEKKEEAG 1067
gi 15602826 1064 ---tpDFE---MIRTLLHHLAEGD---YASDGD-IYWQRVLAq-----qVLDEERLNAIGERTTSWFKLMFEQLEK- 1124
gi 8134454  1022 -----DGQ---DPYPPARECWQTNRFRPGDDDA-PAHVRAWGprapfevLLGKPRAGEEVAGEETRLGALAARLWLP 1089
gi 15837024 1046 -----DTPe--RALQTARARWRGNDHQWGESNH-AAIQLALRnhdpfatPQTAAHFAQLATLIFDLLTTGQADPEPL 1114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap