NCBI CDD Logo
?
COG0724: COG0724 
RNA-binding proteins (RRM domain) [General function prediction only]
Statistics
?
PSSM-Id: 223796
View PSSM: COG0724
Aligned: 121 rows
Threshold Bit Score: 33.767
Threshold Setting Gi: 2497065
Created: 7-Oct-2002
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

COG0724 is classified as a model that may span more than one domain.
COG0724 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2497065   244 YLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPKCLPTFIESEALTEN 323
gi 19073946    1 --------------------------------MISKLFVSNFPESYSEESMSLIFNPFGEIKSIKILREPRLFSIIEFQE 48
gi 19173378    2 LCMAAGGGIYDKKALPSRMRIVVKNLPASTTKEEIEKEFSRHGKITDVFMARNEQGKFRRICFVGYMEEKDGVEAIRYRD 81
gi 19074720   78 LHNRQIRVMKKDERPPETGNIFVKNLPEDFTGKDLDDAFSMFGEIVSCKVATTSHGKSKGYGFVQFKEKKAAKKVIKNFS 157
gi 3123239   151 CRIMWSQRDPSLRKMGTGNVFIKNLDPAIDNKALHDT-FSAFGKILSCKVAVDELGNAKGYGFVHFDSVESANAAIEHVN 229
gi 6016322     1 --------------------MSSSKSLDWADDEDYGTGLPSIQTFDNPDGTKTMIEFRIDDNGKKVKVTRVIRKTVITER 60
gi 417441    109 CRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDT-FSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
gi 417810      1 ---------------------------------MSAEIEEATNAVNNLSINDSEQQPRAPTHKTVIDPEDTIFIGNVAHE 47
gi 6324532    28 SCGPINKLEVKSKTRTVLPDSKKRERAAEADQEEKEASKPDVSDEQTEEVALPKVKKAKKSKRNDEDEDLEARYYAKLLN 107
gi 115936     33 KRSKIIQMTTETFEDIKLEDIPVDDIDFSDLEEQYKVTEEFNFDQYIVVNGAPVIPSAKVPVLKKALTSLFSKAGKVVNM 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2497065   324 AEEADITNGSTMISASLHHNIANKDATRSIIIEfksPveKSDLFKKKLQfldrsknkryilesidlvntdvpsnqfpeny 403
gi 19073946   49 PLDAKAAMDSLGGRRVYGHNEPLHIEMAFDRK--------KRVAVSGIP------------------------------- 89
gi 19173378   82 GSLFKNQRIACEEVREGSPEIGESEERMIKYS--------RKIFIRNVP------------------------------- 122
gi 19074720  158 SLDGLLLGGNRIVVELYN-PEIKKGESKKTSA----T--FTNCFIKNFP------------------------------- 199
gi 3123239   230 GMLLNDKKVYVGHHVSRRERQSKVEALKANF---------TNVYIKNLD------------------------------- 269
gi 6016322    61 VQHAVAERKKWKKFGKEAGKNSGVDARTTSVG-------ENVQLRLQLG------------------------------- 102
gi 417441    188 GMLLNGQEIYVAPHLSRKERDSQLEETKAHY---------TNLYVKNIN------------------------------- 227
gi 417810     48 CTEDDLKQLFVEEFGDEVSVEIPIKEHTDGHIP------ASKHALVKFP------------------------------- 90
gi 6324532   108 EEAEAEDDKPTVTKTDETSVPLTSAAKKVDFKEdelEkaERTVFIGNILs------------------------------ 157
gi 115936    113 EFPIDEATGKTKGFLFVECGSMNDAKKIIKSFHgkrLdlKHRLFLYTMKdveryn------------------------- 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2497065   404 avltflNISMAIEVLDYLKKYSKNlgiskcfyvslaplvvssarssvaniyegktsthrlsvpsvtagnnndsnnngnnn 483
gi 19073946   90 ------SDSSKEEVLKFFQYYGSV-------------------------------------------------------- 107
gi 19173378  123 ------AEANEQFVRDVFKEYGEIeevgll-------------------------------------------------- 146
gi 19074720  200 ------FDASEAELLELLERYGKV-------------------------------------------------------- 217
gi 3123239   270 ------TEITEQEFSDLFGQFGEI-------------------------------------------------------- 287
gi 6016322   103 ------WTTTKEEEQDEAALAAAK-------------------------------------------------------- 120
gi 417441    228 ------SETTDEQFQELFAKFGPI-------------------------------------------------------- 245
gi 417810     91 ------TKIDFDNIKENYDTKVVKd------------------------------------------------------- 109
gi 6324532   158 ------TVITSKKVYKEFKKLFGTn------------------------------------------------------- 176
gi 115936    168 -sddfdTEFREPDMPTFVPSSSLKswlmddkvrdqfvlqddvktsvfwnsmfneedslvesrenwstnyvrfspkgtylf 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2497065   484 ksnmsgittlnnnssigvsvyghsnmsltslsSSVSLNEEIdmlatkLQGVELDGTYLEINYRDYQTPTIEEHSthlsnv 563
gi 19073946  108 -----------------------------------EN-ITH--------GDDMQTIFIDFSSQQDAESFLELDQ------ 137
gi 19173378  147 ---------------------------drregKGAYVKFSRge---cALEAYRKVQFIGGVKARMCPWKDRAEKrqy--- 193
gi 19074720  218 --------------------------------TSLFFPVK-------DNGKPKGFAFANFENHESALNAIKNLHg----- 253
gi 3123239   288 --------------------------------TSLSLVKD-------QNDKPRGFGFVNYANHECAQKAVDELN------ 322
gi 6016322   121 ----------------------------------VKAKGSS-------VVRCRACKGNHFTAQCPYKSIIGPVD------ 153
gi 417441    246 --------------------------------VSASLEKD-------ADGKLKGFGFVNYEKHEDAVKAVEALN------ 280
gi 417810    110 --------------------------------REIHIKRAR------TPGQMQRGGFRGRGGFRGRGGFRGGFR------ 145
gi 6324532   177 -------------------------------pIAETEESGNe----kEEESSKKSDNNEFAIESIRFRSISFDEal---- 217
gi 115936    247 syhqqgvtawggpnfdrlrrfyhpdvrnssvspnekylvtfstepiiveednefspftkkneghqlciwdiasgllmatf 326
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2497065   564 kiskttensrqfsqdipsplplnehmfmndsnqsngaiipqqliatpspvspNLQMNQRVLPNPITQSleqnfnvsakva 643
gi 19073946  138 ----------------------------------------------------KISFGKEKCRLSIKP------------- 152
gi 19173378  194 -------------------------------------------------ehyNTLFFSFESIVKRICEs----------- 213
gi 19074720  254 ----------------------------------------------------TFPFGAGRDGTGEAFYi----------- 270
gi 3123239   323 ----------------------------------------------------DKEYKGKKLYVGR--------------- 335
gi 6016322   154 ----------------------------------------------------EPPLDASPVSSRASGAl----------- 170
gi 417441    281 ----------------------------------------------------DSELNGEKLYVGR--------------- 293
gi 417810    146 ----------------------------------------------------GGYRGGFRGRGNFR-------------- 159
gi 6324532   218 --------------------------------------------------prKVAFVQQKFHKSRDTIn----------- 236
gi 115936    327 pvikspylkwplvrwsyndkycarmvgdslivhdatknfmpleakalkpsgirdfsfapegvklqpfrngdepsvllayw 406
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2497065   644 ssmgsdignrtiyigNINPRSKAEDIcnvvrggilqsikyipekkicfvtfieapsAVQFYANSFidpivlhgnmlrvgw 723
gi 19073946  153 ----------------FTKRERKD----------------------------------SVLSPER--------------- 167
gi 19173378  214 --------------eRVSIRDVVDVNdkdlgar----------------mariethLVQETKKFLe-------------- 249
gi 19074720  271 ---------------qKGQRKEER---------------------------------AEELRKMF--------------- 287
gi 3123239   336 ----------------AQKKHERE--------------------------------EELRKRYEQ--------------- 352
gi 6016322   171 --------------gEKGRYIAPHLR-------------------------------AGSGRESG--------------- 190
gi 417441    294 ----------------AQKKNERM--------------------------------HVLKKQYEA--------------- 310
gi 417810    160 ---------------GRGGARGGFNG-----------------------------------QKRE--------------- 174
gi 6324532   237 ----------------AYIVYKNKSAvrk------------------------icsNLNAVVFQDhhl------------ 264
gi 115936    407 tpetnnsactatiaevprgrvlktvnlvqvsnvtlhwqnqaeflcfnverhtksgktqfsnlqicrlterdipvekvelk 486
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2497065   724 ghysgplpklislavtigasrnvyvslpeFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIeqinylsdshccw 803
gi 19073946  168 -----------------------------SVFIYNLSPRTTRTDLADLFVKFGEIRSLGILSGGKAF------------- 205
gi 19173378  250 -----------------------------SNGIYLDHLTGSVDRNMLIVRNMELMKCLDLVDDRCKIsv----------- 289
gi 19074720  288 -----------------------------EQMSMQGQSYKKNLYITNIPEGFGCEELGSIFKEFGNI------------- 325
gi 3123239   353 -----------------------------MKLEKMNKYQGVNLFIKNLQDEVDDERLKAEFSAFGTI------------- 390
gi 6016322   191 -----------------------------DSMFKRERDDSATLRVTNLSDDTREEELRDLFRRFGGIqr----------- 230
gi 417441    311 -----------------------------YRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTI------------- 348
gi 417810    175 -----------------------------KIPLDQMERSKDTLYINNVPFKATKEEVAEFFGTDADSis----------- 214
gi 6324532   265 --------------------------rvdSVAHPAPHDKKRSIFVGNLDFEEIEESLWKHFEPCGDIey----------- 307
gi 115936    487 dsvfefgwephgnrfvtisvhevadmnyaipantirfyapetkektdvikrwslvkeipktfantvswspagrfvvvgal 566
                        570       580       590       600       610       620       630
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 2497065   804 infmnISSAISLVEEMNKESTVQNeSGEVTLKRATEEKFGgrykgllinygkdrcgnINKNLIAGKNSRFYKKVKRP 880
gi 19073946  206 -----VNYDKELSALKAIRHMDGKsVGGKKIRIALKSMKK-----------------GLHRHV-------------- 246
gi 19173378  290 ----aPSKCLALLKFDKEEDARRCyRKLSLKRVKEHVVYC-----------------EYAPICSVPESTGEEPSKRP 345
gi 19074720  326 -----TSISVGVDGANS-QKQYAY-ICYSTPEEASIAVER-----------------GNEIYLDGNRLQVAYFKNKL 378
gi 3123239   391 -----TSAKIMTDEQGK-SKGFGF-VCYTTPEEANKAVTE-----------------MNQRMLAGKPLYVALAQRKE 443
gi 6016322   231 ----vYLAKDKETGRAKGFAFVSYyDRDCAIKARDRLDGY-----------------GWNNLILRCEFSKPRD---- 282
gi 417441    349 -----TSAKVMRTENGK-SKGFGF-VCFSTPEEATKAITE-----------------KNQQIVAGKPLYVAIAQRKD 401
gi 417810    215 ----lPMRKMRDQHTGRIFTSDSAnRGMAFVTFSGENVDI-----------------EAKAEEFKGKVFGDRELTVD 270
gi 6324532   308 ----vRIIRDSKTNMGKGFAYVQFkDLQSVNKALLLNEKP-----------------MKSQKQEDENTKKPTKKARK 363
gi 115936    567 vgpnmrrsdlqfydmdypgeknindnndvsaslkdvahptysaatnitwdpsgryvtawssslkhkvehgykifnia 643
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap