NCBI CDD Logo
?
pfam00664: ABC_membrane 
Click on image for an interactive view with Cn3D
ABC transporter transmembrane region
This family represents a unit of six transmembrane helices. Many members of the ABC transporter family (pfam00005) have two such regions.
Statistics
?
PSSM-Id: 216049
View PSSM: pfam00664
Aligned: 73 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Dec-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
pfam00664 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3G60_A         50 MLVGTLAAIIHGVALPL--MMLIFGDMTDS---FasvgnvsknstnmseadkraMFAKLE---EEMTTYAYYYT------ 115
gi 116141     871 VLILCLVIFLAEVAASLagLWIISGLAINTgsqT--------------------NDTSTDl--SHLSVFSKFITngshyy 928
gi 20141218   857 VLIWCVLVFLVEVAASL--FVLWLLKNNPV---N--------------------SGNNGTk--ISNSSYVVIITstsfyy 909
gi 116142     864 ILVFCLVIFFVEVAASSa-WLWIIKRNAPAinmT--------------------SNENVS---EVSDTLSVIVThtsfyy 919
gi 1170904    937 LEAWGCLLATFALTECV---TAASSVWLSI---W--------------------STG--S---LMWSADTYLYV------ 979
gi 296439301  972 LFISFLSIFLFMCNHVS---ALASNYWLSL---W--------------------TDDPIVngtQEHTKVRLSVY------ 1019
gi 1730876    894 FIALPLYAILVVGTTFC---SLFSSVWLSY---W--------------------TENKFK---NRPPSFYMGLY------ 938
gi 1723255    918 IFLYFLFIIGGIGMNVG--TNVWLKHWSE----V--------------------NTQLGY---NPKPYFYLGIYt----- 963
gi 1708986    167 TRQKLLVINIVIAALLVtlVSILGSYYLQG---I--------------------IDTYIPn-nMKNTLGIVSLG------ 216
gi 18274372   162 VKQRGLIANIVLATLLVtvINIVGSYYLQS---I--------------------IDTYVPd-qMRSTLGIISIG------ 211
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3G60_A        116 --GIGAGVLIVAYIQVSFWC--LAagRQIHKIRQKFFHA-IMNQEIGW----FDVHDVGELNTRLTDDVSKINEGIGDKI 186
gi 116141     929 ifYIYVGLADSFLALGVIRGlpLV--HTLVTVSKDLHKQ-MLHSVLQGpmtaFNKMKAGRILNRFIKDTAIIDDMLPLTV 1005
gi 20141218   910 ifYIYVGVADTLLALSLFRGlpLV--HTLITASKILHRK-MLHSILHApmstISKLKAGGILNRFSKDIAILDDFLPLTI 986
gi 116142     920 vfYIYVGVADSLLALGIFRGlpLV--HSLISVSKVLHKK-MLHAILHApmstFNTMRAGRILNRFSKDTAILDDILPLSI 996
gi 1170904    980 --YLFIVFLEIFGSPLRFFL---C--YYLIRIGSRNMHRdLLESIGVArmsfFDTTPVGRVLNRFTKDMSILDNTLNDGY 1052
gi 296439301 1020 --G-ALGISQGIAVFGYSMA--VS--IGGILASRCLHVD-LLHSILRSpmsfFERTPSGNLVNRFSKELDTVDSMIPEVI 1091
gi 1730876    939 --SFFVFAAFIFMNGQFTIL---C--AMGIMASKWLNLR-AVKRILHTpmsyIDTTPLGRILNRFTKDTDSLDNELTESL 1010
gi 1723255    964 --LFGLLSCALISLSSLTIT---V--FCAIKSCRYLHDS-MVKAVLRApmsfFETTPTGRILNRFSSDVYRVDEVISRVF 1035
gi 1708986    217 --LIFAYVIQQLLSYARDYL--LI--VMGQRLSIDIILS-YIKHIFELpmsfFATRRTGEIVSRFT-DANAIIEALASTM 288
gi 18274372   212 --LVIVYIFQQILSYAQEYL--LL--VLGQRLSIDVILS-YIKHVFHLpmsfFATRRTGEIVSRFT-DANSIIDALASTI 283
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3G60_A        187 GMFFQAMATFFGGFIIGFTRGWKLTLVILAISPVLGLSAGIWAKILSSFTDKELHAYAKAGAVAEEVLAAIRTVIAFGGQ 266
gi 116141    1006 FDFVQLILIVVGAICVVSVLQPYTLLAAIPVAVIFIMLRAYFLRTSQQLKQLESEARSPIFSHLITSLRGLWTVRAFGRQ 1085
gi 20141218   987 FDFIQLVFIVIGAIIVVSALQPYIFLATVPGLVVFILLRAYFLHTAQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFRRQ 1066
gi 116142     997 FDLTQLVLIVIGAITVVSLLEPYIFLATVPVIVAFILLRSYFLHTSQQLKQLESKARSPIFAHLITSLKGLWTLRAFGRQ 1076
gi 1170904   1053 LYLLEYFFSMCSTVIIMVVVQPFVLVAIVPCVYSYYKLMQVYNASNRETRRIKSIAHSPVFTLLEESLQGQRTIATYGKL 1132
gi 296439301 1092 KMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQ 1171
gi 1730876   1011 RLMTSQFANIVGVCVMCIVYLPWFAIAIPFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQ 1090
gi 1723255   1036 MFFFRNLFQIVFVLAVICYSSPMFMILIVPLFFLYRYNQVYYTQTSRELKRLDSVTRSPLYAHFQESLGGLSTIRAYDME 1115
gi 1708986    289 LSVFLDLGILVIVGTVLVVQNSTLFLISLIAIPAYALVVWLFMRPFSKMNNDQMQAGSMLSSSIIEDINGVETIKALNSE 368
gi 18274372   284 LSIFLDVSTVVIISLVLFSQNTNLFFMTLLALPIYTVIIFAFMKPFEKMNRDTMEANAVLSSSIIEDINGIETIKSLTSE 363
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
3G60_A        267 KKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLv---ISKEYSIGQVLTVFFSVLIGAFSV 341
gi 116141    1086 SYFETLFHKALNLHTANWFLYLSTLRWFQMRIDIVFVL-FFIAVTFIAIAth-dVGEGQVGIILTLAMNITSTLQWAV 1161
gi 20141218  1067 TYFETLFHKALNLHTANWFMYLATLRWFQMRIDMIFVL-FFIVVTFISILtt-gEGEGTAGIILTLAMNIMSTLQWAV 1142
gi 116142    1077 PYFETLFHKALNLHTANWFLYLSTLRWFQMTIEMIFVI-FFIAVSFISIAts-gAGEEKVGIVLTLAMNIMNTLQWAV 1152
gi 1170904   1133 HLVLQEALGRLDVVYSALYMQNVSNRWLGVRLEFLSCV-VTFMVAFIGVIg---KMEGASSQNIGL-ISLSLTMSMTL 1205
gi 296439301 1172 ERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISrh-sLSAGLVGLSVSYSLQVTTYLNWLV 1248
gi 1730876   1091 ERFLAKSDFLINKMNEAGYLVVVLQRWVGIFLDMVAIA-FALIITLLCVTrafpISAASVGVLLTYVLQLPGLLNTIL 1167
gi 1723255   1116 DTFISENDIRVDTNHRIWFLYFSSNRWQAIRVEAIGAL-VVFSSAFFGVLs--aVRGNPNSGLVGLSLSYAVQITQSL 1190
gi 1708986    369 ATAYHKIDHEFVTYLEKSFVYAKTEAVQNAIKSLLQLSLNVVILWVGAQLv---MTNKISVGQLITYNALLGFFTDPL 443
gi 18274372   364 SQRYQKIDKEFVDYLKKSFTYSRAESQQKALKKVAHLLLNVGILWMGAVLv---MDGKMSLGQLITYNTLLVYFTNPL 438
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D