Conserved Protein Domain Family
p450

?
pfam00067: p450 
Click on image for an interactive view with Cn3D
Cytochrome P450
Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.
Statistics
?
PSSM-Id: 215689
View PSSM: pfam00067
Aligned: 50 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Dec-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam00067 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3N9Y_A        12 PSPGDNGWLNLYHFWReTg---THKVHLHHVQNFQKY--GPIYREKLGN-VESVYVIDPEDVALLFKSEGpnpERflIPP 85
gi 56757430   52 PQPPKRNWFLGHLGLIhS----SEEGLLYTQSLACTF--GDMCCWWVGPwHAIVRIFHPTYIKPVLFAPAa-iVP--KDK 122
gi 461810     52 PQPPKRNWLMGHVGMVtPt---EQGLKELTRLVGTYP--QGFLMWIGPM-VPVITLCHSDIVRSILNASa--aVAl-KDV 122
gi 48429213   47 PGPP-THWLFGHALEIq----eTGSLDKVVSWAHQFP--YAHPLWFGQF-IGFLNIYEPDYAKAVYSRGd--pKAp-D-- 113
gi 146345404  52 PSPP-FHWFFGHKQFQg-----DKELQQIMTCVENFP--SAFPRWFWGS-KAYLIVYDPDYMKVILGRSd--pKAngVYR 120
gi 117164     52 PSTP-SHWLWGHNLK-------DREFQQVLTWVEKFP--GACLQWLSGS-TARVLLYDPDYVKVVLGRSd--pKP----- 113
gi 6166034    37 PGPT-PLPFIGTILEYrKg------IWDFDIECRKKY--GKMWGLFDGR-QPLMVITDPDMIKTVLVKECy-sVFt-NRR 104
gi 117153     39 PGPK-PLPFFGTVLNYyMg------LWKFDVECHKKY--GKIWGLFDGQ-MPLFAITDTEMIKNVLVKECf-sVFt-NRR 106
gi 416831     31 VAGPKPVPFFGNLKDSvLr---RKPQVMVYKSIYDEFpnEKVVGIYRMT-TPSVLLRDLDIIKHVLIKDFesfADrgVEF 106
gi 12644217   32 PHDA-PHPLYGNMVGFrKnrvmHDFFYDYYNKYRKSG--FPFVGFYFLH-KPAAFIVDTQLAKNILIKDf--sNFa-DRG 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3N9Y_A        86 WVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPeATknFLPLLDAVSRDFVSVLHRRIKKAGsgnySGDISDDLFRF 165
gi 56757430  123 VFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFN-ILkpYMKIFNESVNIMHAKWQLLASEGSa---RLDMFEHISLM 198
gi 461810    123 IFYTILKPWLGDGLLVSAGDKWSRHRRMLTPAFHFN-ILkpYVKIFNDSTNIMHAKWKRLISEGSs---RLDMFEHVSLM 198
gi 48429213  114 -VYDFFLQWIGRGLLVLEGPKWLQHRKLLTPGFHYD-VLkpYVAVFTESTRIMLDKWEEKAREGK----SFDIFCDVGHM 187
gi 146345404 121 LLA----PWIGYGLLLLNGQPWFQHRRMLTPAFHYD-ILkpYVKNMADSIRLMLDKWEQLAGQDS----SIEIFQHISLM 191
gi 117164    114 --YQSLAPWIGYGLLLLNGKKWFQHRRMLTPAFHYD-ILkpYVKIMADSVSIMLDKWEKLDDQDH----PLEIFHYVSLM 186
gi 6166034   105 SFG--PVGFMKKAVSISEDEDWKRVRTLLSPTFTSG-KLkeMLPIIAQYGDVLVKNLRQEAEKGK----PVDLKEIFGAY 177
gi 117153    107 DFG--PVGIMGKAVSVAKDEEWKRYRALLSPTFTSG-RLkeMFPIIEQYGDILVKYLKQEAETGK----PVTMKKVFGAY 179
gi 416831    107 SLDG-----LGANIFHADGDRWRSLRNRFTPLFTSG-KLksMLPLMSQVGDRFINSIDEVSQTQP----EQSIHNLVQKF 176
gi 12644217  105 QFHNGRDDPLTQHLFNLDGKKWKDMRQRLTPTFTSG-KMkfMFPTVIKVSEEFVKVITEQVPAAQng-aVLEIKELMARF 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3N9Y_A       166 AFESITNVIFGERQGmLEEVVNPEAQRFIDAIYQMFhTSVPMLNLPPDl-FRLFRTKTWKDHVAAWDVIFSKADIYTQNF 244
gi 56757430  199 TLDSLQKCVFSF--DsHCQEKPSEYIAAILELSALV-TKRHQQILLYId-FLYYLTPDGQRFRRACRLVHDFTDAVIQER 274
gi 461810    199 TLDSLQKCVFSF--DsNCQEKSSEYIAAILELSALV-AKRHQQPLLFMd-LLYNLTPDGMRFHKACNLVHEFTDAVIRER 274
gi 48429213  188 ALNTLMKCTFGR-GDtGLGHRDSSYYLAVSDLTLLM-QQRLVSFQYHNd-FIYWLTPHGRRFLRACQVAHDHTDQVIRER 264
gi 146345404 192 TLDTVMKCAFSHNGSvQVDGNYKSYIQAIGNLNDLF-HSRVRNIFHQNd-TIYNFSSNGHLFNRACQLAHDHTDGVIKLR 269
gi 117164    187 TLDTVMKCAFSHQGSvQLDVNSRSYTKAVEDLNNLI-FFRVRSAFYGNs-IIYNMSSDGRLSRRACQIAHEHTDGVIKTR 264
gi 6166034   178 SMDVITGTSFGVNIDsLRNPQD-PFVKNVRRL--LK-FSFFDPLLLSIt-LFPFLTPIFEALH-ISMFPKDVMDFLKTSV 251
gi 117153    180 SMDVITSTSFGVNVDsLNNPKD-PFVEKTKKL--LR-FDFFDPLFLSVv-LFPFLTPIYEMLN-ICMFPKDSIEFFKKFV 253
gi 416831    177 TMTNIAACVFGLN---LDEGMLKTLEDLDKHIFTVN--YSAELDMMYPgiLKKLNGSLFPKVVSK--FFDNLTKNVLEMR 249
gi 12644217  183 TTDVIGTCAFGIECNtLRTPVS-DFRTMGQKV--FT-DMRHGKLLTMFv-FS--FPKLASRLR-MRMMPEDVHQFFMRLV 254
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3N9Y_A       245 YWELRQKg--------sVHHDYRGILYRLLGd---------------sKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYE 301
gi 56757430  275 RRTLPSQgvddflqakaKSKTLDFIDVLLLSkde-----------dgkKLSDEDIRAEADTFMFEGHDTTASGLSWVLYH 343
gi 461810    275 RRTLPDQgldeflkskaKSKTLDFIDVLLLTkde-----------dgkELSDEDIRAEADTFMFEGHDTTASGLSWILYN 343
gi 48429213  265 KAALQDEkvrk---kiqNRRHLDFLDILLGArde-----------ddiKLSDADLRAEVDTFMFEGHDTTTSGISWFLYC 330
gi 146345404 270 KDQLQNAgele---kvkKKRRLDFLDILLLArme-----------ngdSLSDKDLRAEVDTFMFEGHDTTASGVSWIFYA 335
gi 117164    265 KAQLQNEeelq---karKKRHLDFLDILLFAkme-----------dgkSLSDEDLRAEVDTFMFEGHDTTASGISWVFYA 330
gi 6166034   252 EKIKDDRlk------dkQKRRVDFLQLMINSqnske-------idshkALDDIEVVAQSIIILFAGYETTSSTLSFIMHL 318
gi 117153    254 YRMKETRld------svQKHRVDFLQLMMNAhndskd------keshtALSDMEITAQSIIFIFAGYEPTSSTLSFVLHS 321
gi 416831    250 KGTPSYQ----------K-DMIDLIQELREKktlelsrkhenedvkalELTDGVISAQMFIFYMAGYETSATTMTYLFYE 318
gi 12644217  255 NDTIALRer------enFK-RNDFMNLLIELkqkgrvtl--dngevieGMDIGELAAQVFVFYVAGFETSSSTMSYCLYE 325
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3N9Y_A       302 MARNLKVQDMLRAEVLAAR-HQa--qGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRD---YMIPAKTLV 375
gi 56757430  344 LAKHPEYQERCRQEVQELL-KDrepkEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDg--RVIPKGIIC 420
gi 461810    344 LANDPEYQERCRQEVQELL-RDrdpeEIEWDDLAQLPFLTMCIKESLRLHPPVTVISRCCTQDILLPDg--RTIPKGIIC 420
gi 48429213  331 MALYPEHQHRCREEVREIL-GDq--dFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDg--RSLPAGSLI 405
gi 146345404 336 LATHPEHQQRCREEVQSVL-GDg--sSITWDHLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFPDg--RSLPKGIQV 410
gi 117164    331 LATHPEHQERCREEVQSIL-GDg--tSVTWDHLDQMPYTTMCIKEALRLYSPVPSVSRELSSPVTFPDg--RSIPKGIRV 405
gi 6166034   319 LATHPDVQQKLQEEIDTLL-PNk--eLATYDTLVKMEYLDMVVNETLRLYPIAGRLERVCKKDVDING---TFIPKGTIV 392
gi 117153    322 LATHPDTQKKLQEEIDRAL-PNk--aPPTYDTVMEMEYLDMVLNETLRLYPIGNRLERVCKKDVEING---VFMPKGSVV 395
gi 416831    319 LAKNPDIQDKLIAEIDEVLsRHd--gNITYECLSEMTYLSKVFDETLRKYPVADFTQRNAKTDYVFPGt-dITIKKGQTI 395
gi 12644217  326 LAQNQDIQDRLRNEIQTVL-EEqe-gQLTYESIKAMTYLNQVISETLRLYTLVPHLERKALNDYVVPGhekLVIEKGTQV 403
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3N9Y_A       376 QVAIYALGREPTFFFDPENFDPTRWLSKDKN-ITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVG 454
gi 56757430  421 LISVFGTHHNPAVWPDPEVYDPFRFDPKNIKeRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRVLPDH-TEPR 499
gi 461810    421 LISIFGIHHNPSVWPDPEVYNPFRFDPENIKdSSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRLLPD--DKEP 498
gi 48429213  406 SMHIYALHRNSAVWPDPEVFDSLRFSTENASkRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDP-SRLP 484
gi 146345404 411 TLSIYGLHHNPKVWPNPEVFDPSRFAPD--SpRHSHSFLPFSGGARNCIGKQFAMSEMKVIVALTLLRFELLPDP-TKVP 487
gi 117164    406 TILIYGLHHNPSYWPNPKVFDPSRFSPD--SpRHSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDP-TRIP 482
gi 6166034   393 MMPTYALHRDPQHWTEPDEFRPERFSKKNKDnINPYIYHPFGAGPRNCLGMRFALMNIKLALVRLMQNFSFKLCKETQVP 472
gi 117153    396 MIPSYALHRDPQHWPEPEEFRPERFSKENKGsIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQIP 475
gi 416831    396 IVSTWGIQNDPKYYPNPEKFDPERFNPENVKdRHPCAYLPFSAGPRNCLGMRFAKWQSEVCIMKVLSKYRVEPSMKSSGP 475
gi 12644217  404 IIPACAYHRDEDLYPNPETFDPERFSPEKVAaRESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVCDTTEIP 483
                        490       500
                 ....*....|....*....|
3N9Y_A       455 TTFNL---ILMPEKPISFTF 471
gi 56757430  500 RKPE----LVLRAEGGLWLR 515
gi 461810    499 RRQPE---LILRAEGGLWLR 515
gi 48429213  485 IKMPQ---LVLRSKNGFHLH 501
gi 146345404 488 IPLPR---LVLKSKNGIYLY 504
gi 117164    483 VPMPR---LVLKSKNGIHLR 499
gi 6166034   473 LKLGKq-gLLQPEKPIVLKV 491
gi 117153    476 LKLSRq-gLLQPTKPIILKV 494
gi 416831    476 FKFDPmrlFALPKGGIYVNL 495
gi 12644217  484 LKYSPm-sIVLGTVGGIYLR 502
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D