NCBI CDD Logo
?
smart00435: TOPEUc 
Click on image for an interactive view with Cn3D
DNA Topoisomerase I (eukaryota)
DNA Topoisomerase I (eukaryota), DNA topoisomerase V, Vaccina virus topoisomerase, Variola virus topoisomerase, Shope fibroma virus topoisomeras
Statistics
?
PSSM-Id: 214661
View PSSM: smart00435
Aligned: 24 rows
Threshold Bit Score: 515.361
Threshold Setting Gi: 474909
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:

smart00435 is classified as a model that may span more than one domain.
smart00435 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1A35_A        186 LFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPS---PPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIK 262
gi 3170997    287 LFRGRGDHPKTGKLKTRVVPEQVIINIGKDSVIPS---PPPGHNWKEVRHDNTVTWLATWNENVNNNVKYVFLSAGSSLK 363
gi 5119       337 LFRGRGSHPKTGSLKRRVYPEQITINIGEGVPVPE---PLPGHQWAEVKHDNTVTWLATWHENINNNVKYVFLAAGSSLK 413
gi 256273990  268 LFRGRGAHPKTGKLKRRVNPEDIVLNLSKDAPVPP---APEGHKWGEIRHDNTVQWLAMWRENIFNSFKYVRLAANSSLK 344
gi 27752875   393 LFRGRGEHPKTGRVKARVQPEQITINIGKEARVPP---PPEGHKWKEVKHDQEGTWLAMWQENINGNYKYVMLAANSDVK 469
gi 2245428    393 LFRGRGEHPKTGRVKARVQPEQITINIGKEARVPP---PPEGHKWKEVKHDQEGTWLAMWQENINGNYKYVMLAANSDVK 469
gi 1762119    304 LFRGRGAHPKTGKLKRRVVSEQVTLNLGKDAKIPE---PPAGHQWGEIRHDNEVTWLAMWKENISDSLKYVRFANNSSVK 380
gi 2501243    302 LFRGRGAHPKTGKLKRRVVSEQVTLNLGKDAKIPE---PPAGHQWGEIRHDNEVTWLAMWKENISDSLKYVRFANNSSVK 378
gi 2642493    553 LFLGRGAHPKTGLVKKRIEAEDITINIGKGVPVPE---PPPGHKWCKVVHDDKVAWLAMWKENINNGFKYVWLHASSAVK 629
gi 124506131  308 LFRGRGEHPKQGLLKKRIFPEDVVINISKDAPVPRlydNMCGHNWGDIYHDNKVTWLAYYKDSINDQIKYTFLSAQSKFK 387
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1A35_A        263 GEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEgETADTVGCCSLRVEHINLHP 342
gi 3170997    364 GQSDLKKYEKARELKLYIDNIRKQYRKELEDKLMEVRQRATAMYLIDLFALRAGNEKGE-DEADTVGCCSLRYEHISLSP 442
gi 5119       414 GQSDLKKYEKSRKLKDYIDDIRKGYRKDLKNELTVERQRGTAMYLIDVFALRAGNEKGE-DEADTVGCCSLRYEHVTLKP 492
gi 256273990  345 GQSDYKKFEKARQLKSYIDAIRRDYTRNLKSKVMLERQKAVAIYLIDVFALRAGGEKSE-DEADTVGCCSLRYEHVTLKP 423
gi 27752875   470 GQSDYKKFEKARELKKHIARIRKDYQKNLKHELMVERQKATAVYLIDQFALRAGNEKGE-DEAETVGCCSLKYENVTLKP 548
gi 2245428    470 GQSDYKKFEKARELKKHIARIRKDYQKNLKHELMVERQKATAVYLIDQFALRAGNEKGE-DEAETVGCCSLKYENVTLKP 548
gi 1762119    381 GQSDFKKFETARKLRDHVDSIRKDYTKMLKSEKMQDRQMATAMYLIDVFALRAGGEKGE-DEADTVGCCSLRYEHVTLKP 459
gi 2501243    379 GQSDFKKFETARKLRDHVDSIRKDYTKMLKSEKMQDRQMATAMYLIDVFALRAGGEKGE-DEADTVGCCSLRYEHVTLKP 457
gi 2642493    630 GRSDMKKFEVARKLKDHIEKIRKKYLKELGSEELEERQRATAIYLIDRLALRVGNEKDE-DTADTVGCCSLRVEHVTLKE 708
gi 124506131  388 GYKDLMKYENARKLKSCVHKIREDYKNKMKNKNIIDKQLGTAVYLIDFLALRVGGEKDIdEEADTVGCCSLRVEHISFAH 467
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1A35_A        343 ELDGQeyv-----------------------------veFDFLGKDSIRYYNKVPVEKRVFKNLQLFME-------N-KQ 385
gi 3170997    443 PNTVV----------------------------------FDFLGKDSIRYYNEVQVDPQVFKNLKIFKRs------P-KT 481
gi 5119       493 PRTVV----------------------------------FDFLGKDSIRYYNEVEVDPQVFKNLKIFKR-------PpKK 531
gi 256273990  424 PNTVI----------------------------------FDFLGKDSIRFYQEVEVDKQVFKNLTIFKRp------P-KQ 462
gi 27752875   549 PNKVI----------------------------------FDFLGKDSIRFYDEVEVDPQVFKNLKIFKKp------P-KK 587
gi 2245428    549 PNKVI----------------------------------FDFLGKDSIRFYDEVEVDPQVFKNLKIFKKp------P-KK 587
gi 1762119    460 PNKVI----------------------------------FDFLGKDSIRFYQEVEVDKQVFKNLRIFKKs------P-KQ 498
gi 2501243    458 PNKVI----------------------------------FDLLGKDSIRFYQEVEVDKQVFKNLRIFKKs------P-KQ 496
gi 2642493    709 PASVT----------------------------------LDFLGKDSMRYHNTVDVDPRVFKNLSEFMYkggnkkaP-KK 753
gi 124506131  468 DIPFKsvdskeqktndekvnkiplptnlesissedcyitLDFLGKDSIRYFNTVKIDKQAYINIIIFCK-------N-KN 539
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1A35_A        386 PEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTa-------------------------------- 433
gi 3170997    482 EGDMLFDRLNTSKLNNHLTSLMPGLSAKVFRTHNASYTMSEQLKNTP--------------------------------- 528
gi 5119       532 EGDLIFDRLSTNSLNKYLTSLMDGLSAKVFRTYNASYTMAEELKKMP--------------------------------- 578
gi 256273990  463 PGHQLFDRLDPSILNKYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPn-------------------------------- 510
gi 27752875   588 EGDEIFDRLTTSALNKHLSQYMPGLTAKVFRTYNASHTMSELLKSMHa-------------------------------- 635
gi 2245428    588 EGDEIFDRLTTSALNKHLSQYMPGLTAKVFRTYNASHTMSELLKSMHa-------------------------------- 635
gi 1762119    499 PGDDLFDRINPSLVNRQLQNYMKGLTAKVFRTYNASKTMQDQIDIIEn-------------------------------- 546
gi 2501243    497 PGDDLFDRINPSLVNRQLQNYMKGLTAKVFRTYNASKTMQDQIDIIEn-------------------------------- 544
gi 2642493    754 PENDLFDQLTTSSLNKYLKGFMENLSAKVFRTYNASLTLEKELAKMPes------------------------------- 802
gi 124506131  540 RDEGVFDQITCSKLNEYLKEIMPTLSAKVFRTYNASITLDQQLKRIKevygkttyslysgetelhkskkrksshltsdtn 619
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1A35_A        434 -----------------------------------------------PDENIPAKILSYNRANRAVAILCNHQRAPPKTF 466
gi 3170997    529 -----------------------------------------------KDASISDKVLAYNRANRMVAILCNHQRTISKTH 561
gi 5119       579 -----------------------------------------------KNLTLADKILFYNRANRTVAILCNHQRSVTKNH 611
gi 256273990  511 -----------------------------------------------K-GSVAEKILKYNAANRTVAILCNHQRTVTKGH 542
gi 27752875   636 ------------------------------------------------TGNNAEKVKAYNDANRKVAILCNHKRTVGAAH 667
gi 2245428    636 ------------------------------------------------TGNNAEKVKAYNDANRKVAILCNHKRTVGAVT 667
gi 1762119    547 ------------------------------------------------EGTVAEKVAKFNAANRTVAILCNHQRTVSKTH 578
gi 2501243    545 ------------------------------------------------EGTVAEKVAKFNAANRTVAILCNHQRTVSKTH 576
gi 2642493    803 ----------------------------------------------lIKATADEKVLFYNRCNREVAILCNHQRSLSKTH 836
gi 124506131  620 ilsdasdstindvnneydenginkklsyattvgkendvddknspievDVSNINELINFYNNANREVAILCNHQRSIPKQH 699
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1A35_A        467 EKSMMNLQTKIDAKKEQLA------------------------------DA----------------R------------ 488
gi 3170997    562 SAQMERIEDKILALKYQKIrlrkailtldpkl-----eksrpdlseavsDI----------------D------------ 608
gi 5119       612 DVQMERFAERIKALQYQRMrlrkmml-----------------nlepklAK----------------S------------ 646
gi 256273990  543 AQTVEKANNRIQELEWQKIrckrailqldkdllkkepkyfeeiddltkeDE----------------Atihkri-----i 601
gi 27752875   668 AHQMEKMSERIKGQRYQKWrlkqmmldldpsl----kkkkgaqffeldeDI----------------Dkewikehqafli 727
gi 2245428    668 RDQMEKMSERIKGQRYQKWrlkqmmldldpsl----kkkkgaqffeldeDI----------------Dkewikehqafli 727
gi 1762119    579 GDSVQRINDKLKKFMWQKIrlkkmilqlepkl-----kkkdskyfeeidDLlkediehihhtiikrqR------------ 641
gi 2501243    577 GDSVQRINDKLKKFMWQKIrlkkmilqlepkl-----kkkdskyfeeidDLikediehihhtiikrqR------------ 639
gi 2642493    837 TETMGKIDEKIAEFKKEKLqqqiaylkgkg---------kkpvlsdsesDE----------------Dtpkkatp---kk 888
gi 124506131  700 DTTMSKIKKQIELYNEDIKeykkylq-----------------hlkknsDK----------------Kf----------- 735
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1A35_A        489 ----R----------------D----------------------------LKSA------KADAK--------------V 500
gi 3170997    609 ----EdwikehqkvliekeydK----------------------------IKRKfqkdneKLISQ--------------N 642
gi 5119       647 ----K----------------PellakeegitdswivkhhetlyelekekIKKKfdreneKLAAE--------------D 692
gi 256273990  602 dreiE----------------K----------------------------YQRKfvrendKRKFE--------------K 623
gi 27752875   728 eeqaQ----------------K----------------------------IKKKfekdneKLLAE--------------G 749
gi 2245428    728 eeqaQ----------------K----------------------------IKKKfekdneKLLAE--------------G 749
gi 1762119    642 ----E----------------Q----------------------------AKKKlerdneKLKLE--------------G 659
gi 2501243    640 ----E----------------Q----------------------------AKKKlerdneKLKLE--------------G 657
gi 2642493    889 atpkK----------------E----------------------------TKSSdeatpnKKRKKdddeeeaddfketpK 924
gi 124506131  736 ---------------------I----------------------------FVSKvstldgTLRPN--------------K 752
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1A35_A        501 -----------------MKDAKTK-KVVESKKK---------------AVQRLEEQLMKLEVQATDREENKQIALGTSKL 547
gi 3170997    643 etpmpesr-lekflekiNEMKEEF-KIENEKGRvesktrgitietldlQIKKINERIHQMKALMIDKAQNKTTALGTSKI 720
gi 5119       693 pksmlpeselevrlkaaDELKKAL-DAELKSKKvdpgrss--meqlekRLNKLNERINVMRTQMIDKDENKTTALGTSKI 769
gi 256273990  624 eellpesq-lkewlekvDEKKQEF-EKELKTGEvelksswnsvekikaQVEKLEQRIQTSSIQLKDKEENSQVSLGTSKI 701
gi 27752875   750 ekemkase-letrleavKELEKKF-NKENKTGKveaegrsptvekleaSITKLQQRIENMELQAQDKEDNKEVALGTSKI 827
gi 2245428    750 ekemkase-letrleavKELEKKF-NKENKTGKveaegrsptvekleaSITKLQQRIENMELQAQDKEDNKEVALGTSKI 827
gi 1762119    660 kplltesd-ikdkldkiDELEKEY-QKELKTGKpivtkna-tveklkqQIETLENKILNVSIQLKDKEDNSEVSLGTSKM 736
gi 2501243    658 kplltesd-ikdkldkiDELEKEY-QKELKTGKpivtkna-tveklkqQIETLENRILNVSIQLKDKEDNSEVSLGTSKM 734
gi 2642493    925 -----------------KKVKRALpDSVEKCKA---------------AIERVDTSINKWNIKKTEKDELKSVALTTSKI 972
gi 124506131  753 -------------------VKENM-KEESCKKK---------------LIT-LIKKVELLNNQMKVRDDNKTIALGTSKI 796
                         650
                  ....*....|....*.
1A35_A        548 NFLDPRITVAWCKKWG 563
gi 3170997    721 NYIDPRLTYAWCAKYG 736
gi 5119       770 NYIDPRLTYSFSKRED 785
gi 256273990  702 NYIDPRLSVVFCKKYD 717
gi 27752875   828 NYIDPRLTVVFSKKFK 843
gi 2245428    828 NYIDPRLTVVFSKKFK 843
gi 1762119    737 NYIDPRLIVMFSKKFD 752
gi 2501243    735 NYIDPRLIVMFSKKFD 750
gi 2642493    973 NYIDPRITAAWAKRVG 988
gi 124506131  797 NYMDPRITVAFCKKFE 812
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D