Conserved Protein Domain Family
DUF747

?
pfam05346: DUF747 
Eukaryotic membrane protein family
This family is a family of eukaryotic membrane proteins. It was previously annotated as including a putative receptor for human cytomegalovirus gH but this has has since been disputed. Analysis of the mouse Tapt1 protein (transmembrane anterior posterior transformation 1) has shown it to be involved in patterning of the vertebrate axial skeleton.
Statistics
?
PSSM-Id: 203235
View PSSM: pfam05346
Aligned: 36 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Dec-2011
Updated: 5-Jan-2012
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam05346 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74582329   214 PNRSLPRSRKIDLLKLLLIFSTSILIR--KIDVSRLYHIIRAQASIRFYVLYNVLEIADRLCCALGQDVLDCLFSNHILS 291
gi 75169793   330 QFRRPSASELSDLACFLVLAT----------DISLIYHMIRGQSTIKLYVVYNILE------------------------ 375
gi 122155358  144 GIHPYAREHLNDVLWLLMLGMAVTYTH--MIDVSVIYHYIRGQEVIKLYMACHVLETFDKLLCSFNSNVLDALQNSVHGC 221
gi 124477420   75 N--MISIEFRLDLIQTAMIWLITWLFTfnYFEVGFWYHIIRSQSQIKLYGIIQILDLLDRLACTQGDYIIRQLYWQN--- 149
gi 74881068   706 NFLNLSFPEYSGLIRASLILICIYIFS--FLDTSRIYHYIRAQPFMKLYVVLNMLEILERLLRSLGKDLIDNMIRTFIRI 783
gi 121959546 3096 QPPLLAPADVCALVRFSLLVASVSLFL--LVDTSRVYHYIRAQPFMKLYVVFNMLELFEKMWRSLGRDIFDALMRTT--- 3170
gi 122052586  216 EPRNITLTEVCGCVRFLVLLATVYIFS--FIDTSKVYHNIKAQPIMKLYVLFNMLEICERLCRSFNRDIMDSLVKTTINI 293
gi 74777087   382 KYFRFTAVELTDFSRFLVLLLSIYIFS--RLDISFFYHYIRGQGLLKLYFIFNMLEIFEKLFRSFGRDLIDTYLESVIKF 459
gi 145354053  123 gIHPYAREHLNDVLWLFMLCVAVTYTH--MLDVSVIYHYIRGQEVIKLYMACHVLETFDKLLCSFNSNVLDALQNSVHGC 200
gi 156085018  255 ESYVITPIEACGFARFAAMLFAIIILS--RIDTSRVYHNIRGQPFFKLYVIFNMLEICERLCRSFGRDCIDTLMRTTVKI 332
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74582329   292 f------------------------------------------------------------------------------- 292
gi 75169793       --------------------------------------------------------------------------------
gi 122155358  222 vnsat--------------------------------------------------------------------------- 226
gi 124477420      --------------------------------------------------------------------------------
gi 74881068   784 inlrsyiyiirnhynnmtnddenfsneslegrrkktyiinnsnilheegngkkknekikfs------------------- 844
gi 121959546      --------------------------------------------------------------------------------
gi 122052586  294 fiiqfnntnvssarvnfqkpdsqkcqlgnngnksflnsh----------------------------------------- 332
gi 74777087   460 ftyigfvdg----------------------------------------------------------------------- 468
gi 145354053      --------------------------------------------------------------------------------
gi 156085018  333 yklcsnfslrssnalamlnatkrmksgiamdhfmtkkykssvvisnfarveqmatptmrrvtvdvagysertisqsetth 412
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74582329   293 ------------------------------------------------------------------nF---------WNP 297
gi 75169793       --------------------------------------------------------------------------------
gi 122155358  227 ---------------------------------------------------------------ngsvV---------DQA 234
gi 124477420  150 ------------------------------------------------------------------------------VY 151
gi 74881068   845 ------eiftkeyrknsdiyinykginlkknnknnvntnpyfnkeknmfsflknnnemaanfklpifY---------PFL 909
gi 121959546      --------------------------------------------------------------------------------
gi 122052586  333 ----------------------------tnntqnhpnksvnrrssldsegfvpgnktesllsscrnhV---------DGF 375
gi 74777087   469 -----------------------------------------------------------sfkqekshP---------SFT 480
gi 145354053  201 -------------------------------------------------------------------VsaatngskvDQV 213
gi 156085018  413 pysnagtsdlsdkerpiktlsfvgddldlhlnhsedspekhsfvlkdlsatldtiadtvcpdstrelE---------DSG 483
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74582329   298 AGWMTFFYYFAISLAYMVLHTLVLLYQIITLNVTVNSYSNAVLALLMSNQLVEIKGAVF------KKFEKENLFQLTCSD 371
gi 75169793   376 ---------------------------AITLSTCIVAHNNALLALLVSNNFAEIKSSVF------KRFSKDNIHGLVYAD 422
gi 122155358  235 QSALRLIVDISLSTAATVAHTFILLTYAVTLSVAINSHSNAILLVLISNNFAEMKGHVF------KKQDPEKLFGVSRLD 308
gi 124477420  152 KNQSVFNRYLPYSFIYIFAHACLLGLQLTVYNVIFSQKVQLLYLALFVLSLIKLKGSVF------KKQDEKSCITTAIND 225
gi 74881068   910 SILIKFILQYICVLIYILTHAFAHLIRFLSLNIAINSSESTMFLILVMSNFTEIKSTVF------KKFTKISLFTIVASD 983
gi 121959546 3171 ------------------VQLLSRPVQASSASTADEGEENT----ETAERKEETRSSVLafphtwKRHQRESEEGRVCRD 3228
gi 122052586  376 NIYYKFVFLYCFVVLTITFHAFIHLVRVLILNIAINSPEYTMFLVLITNNFGEIKSSVF------KKHTQLSLFIIFASD 449
gi 74777087   481 KLFIDSFSKYFLVIIYLIIHCTIHMIRGLALNISLNSSEYTMFLIVITNNFAEIKSTVF------KTYHSISLFTVSCSD 554
gi 145354053  214 KSGVRLAVDVILSTSATVAHTFILLTHAVTLSVAINSHTNAMLLVLISNNFAEMKGHVF------KKQDPEKLFGVSRLD 287
gi 156085018  484 NAYLEFILRFLLVTIYIIFHSFMHLLRVLILNIAINSSDSAMFLLMVTNNFAEIKSTVF------KKFNETSLFTIVATD 557
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74582329   372 VVERFQITIMVIII--FLRNLAELyttsSLDQPLLtfkrlkTLLAPFFWVIGSELF-VDWLKHAFIIKFNYIKPSIYSRF 448
gi 75169793   423 SIERFHISAFLVSV--LAQNILES------EGAWFg-----NFIYNATTVFFCEMM-IDIIKHSFLAKFNDIKPIAYSEF 488
gi 122155358  309 VIERVHLCVCLLFV--TAQRITAa---gSIEVALTr-----KFMNDIVLVMGSEVF-VDIIKHSFMAKFNGLRPGVYRRF 377
gi 124477420  226 GREYFQKALYIILIsmSVKFTPV------------------DFYYKIGFYFFIELL-VDSFKYISIFHLNSVPINVLNEQ 286
gi 74881068   984 SVERFYLFIDAFLV--LLKMSTAY----RTQNSFL------SITSWLIIILLLEVG-VDWCKHSYLLKYNKLKSESLIRY 1050
gi 121959546 3229 EGGRKR----------------------------------------------KEAEgREEKRRGHRQEEEKENESAFRSR 3262
gi 122052586  450 AVERCHLVLDGLLV--FFKMSTSR----RNLNSYI------SVFSWLFLVYGIEVL-IDLVKHSYLIKFNKLLSETFEKY 516
gi 74777087   555 TIERFQLLYDGCIL--FIRMYSNAr--lYTDSIFS------SVITWVVSVYLVEII-VDWFNHSFLVKFTKINSNCYFSY 623
gi 145354053  288 VIERVHLCVCLMFV--TAQRIMAAg---NLEMALTr-----KFLNDIALVMGSEIF-VDVVKHSFMAKFNGLRPGVYRRF 356
gi 156085018  558 AIERFHLCFDGMIV--FFKMCTVQ----SPWQAYL------QVSRWLSKMLVLEVL-IDYFKHSFLLKFNKIGGELFKRY 624
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74582329   449 TDVLC-----HDYVASGAQLT--------------QTVTGCSQQVARRMGLPVLPLVCVFIRTSMQTWSMFRSThsmkqe 509
gi 75169793   489 LQALC---------------E--------------QTLNIRPEDRKTNLTFVPLAPACVVIRVLTPVYAAHLPYsp---- 535
gi 122155358  378 YRQIC-----RDHV-----------------------HLMQSYKIHQVVGFVPLAPAAVIVRAVPSLFRTLKEGaiesdt 429
gi 124477420  287 TKSLSnfmyaVSIQQDQIKELslidqk--dlcivlQNVPLAQAKIIGKFNIVIFPQVIIILKMLAYNYQKHKSS------ 358
gi 74881068  1051 FQTLL-----ADVLISRTTNNniyymntlsfevpcKNIFSFSHIPTRRLGYMSMPVVTLIVCSLPrl------------- 1112
gi 121959546 3263 ----------EDRE--------------------------------RELEFI---------------------------- 3272
gi 122052586  517 DSVLI-----ADRLLSRSL-YnlrsltfyklkvpcKCSFSFSHISSRRLGFISSPIVTLIISTIPKMGFHI--------- 581
gi 74777087   624 LDPLI-----GDILLSRGSN---------------Q-------------------------------------------- 639
gi 145354053  357 YRQIC-----RDHV-----------------------HLTQSYKIHQVVGFVPLAPAAVIVRVVPGLYRTLKQNamssdi 408
gi 156085018  625 TEVLI-----GDILLSRSL-RnlhmlvrfdfrvicKGVYSFSHIPARRLGFMSSPIMTLIVCNIPYIRSRL--------- 689
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74582329   510 iaksigtifptkdnyvyylpnkeantynagkeaswetllLSVVRGKSGIAFLFfmaimlkLLLGKAILAITQSRYE-SMQ 588
gi 75169793   536 -------------------------------------lpWRMLWMVILFVITYimltslkVLIGMGLRKHATWYIN-RCR 577
gi 122155358  430 lt------------------------------rgnlnkvLASFSTLMVSLGFMlilvcfkLMFGIAIHAWGVRSLSnSSK 479
gi 124477420  359 ---------------------------------------LDKEDYIYIGFIIFimlsftkMIIFFYHRNSQLYLHInKLK 399
gi 74881068  1113 -------------------------------------nyLSNISLLSFALSIWiclflfkIILSIMIVSYTISEKH-QLK 1154
gi 121959546 3273 ------------------------------------------IGGENKESSSEgssaflkCRADVRTTPETDETNG-RLL 3309
gi 122052586  582 -----------------------------------------SPKILIISAFSWlslffvkITTSILLTGYCIKKKD-QIY 619
gi 74777087   640 -------------------------------------------------AFQYlmidfnkKTWKKII----------LLK 660
gi 145354053  409 vt------------------------------rgafdrlLAHFSGRVIGLGVMfiaicfkLAFGIAIYTWGARSLE-Rts 457
gi 156085018  690 -----------------------------------------TVTRFVTALLIWtalfflkVTLSILLLSYGIKKRR-DLL 727
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap