NCBI CDD Logo
?
pfam03089: RAG2 
Recombination activating protein 2
V-D-J recombination is the combinatorial process by which the huge range of immunoglobulin and T cell binding specificity is generated from a limited amount of genetic material. This process is synergistically activated by RAG1 and RAG2 in developing lymphocytes. Defects in RAG2 in humans are a cause of severe combined immunodeficiency B cell negative and Omenn syndrome.
Statistics
?
PSSM-Id: 202530
View PSSM: pfam03089
Aligned: 18 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Dec-2011
Updated: 5-Jan-2012
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam03089 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75570215   21 KHRELKLRPVTFSNESCYLPPLRSSAVTSYLGSGESESLQYLIHGGRTPNNELSDKLYLMTLVSKAyNKKVILCCTEKEL 100
gi 75570223   21 KNGELKLRPISFSNGSCYLPPLRYPAITRM-GPESSEKEKYLIHGGRTPNNELSSRLYIISQDSRGcNKKVILQCIEKEL 99
gi 2498831    51 KHGELKLRPISSSNDSCYLPPLRCPALTRL-EPHDGHPEGYLIHGGRTPNNEISSSLYLLTLDSRGcNRKVTLRCQEREL 129
gi 82174668    1 KRGELKLRPVSFSNDSCYLPPLRCPAVAHL-EPWGSDPECYLIHGGRTPNNEISGNLYLLSQDSRGsNRKVTLCCQEKEL 79
gi 75571634    3 KRGQLKLRAISFSNDSCYLPPLRSPAVTHL-DAWDAEPECYLIHGGRTPNNEISGSLYLLSQESRGcNRKVMLRCREKEL 81
gi 75570216   21 KQQEMKLRPVSFCNDSRYLPPLRSPAICSL-IDSDSEKHQYLLHGGKTPNSDLSDKLYIIKLVSKGvNKKTTLSCIEKEL 99
gi 75570214   21 KKNELKLRPATFSNDTCYLPPLRYPAVTSVKASSESETCQYLIHGGKTPNNELSTKMYIMSTMGKA-NRKATICCTEKEL 99
gi 151335703  50 KNNELRLRPTTFTNDSCYLPPLRHSAVCSLPASQGGEITQYLIHGGKTPNNEISHKLYTMAMASSv-NKRFSLCCSEKDL 128
gi 281182217  15 KGNEIKLRPTTFTNESCYLPPLRHPAVTSFSESPGGEISQYIFHGGKTPNNELSHKLYIMSYVSSA-NKKSSLCCVEKDL 93
gi 86372047    2 KKGELKLRAISFSNNSCYLPPLRCPAIAHF-EPHDGSPECYLIHGGRTPNNELSSSLYMLSVDSRGcNRKVTLRCQEKEL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75570215  101 EGDVPQARYGHTINMVYSRGKSMCVMFGGRSYMSPGQRTTENWNSIEDCMPQVYLIDLEFGCCTSYNFPELQDGMSFHVS 180
gi 75570223  100 VGEVPESRYGHTVNIVHSHGKTACLLFGGRSYVPSGQRTTENWNSVVDCPPLVFLIDLEFGCCTSYNLPQLTDGQSFHVS 179
gi 2498831   130 VGEQPGPRYGHTLSMVQSLGKRACVVFGGRSYMPAGERTTENWNSVVDCPPQVFIIDLEFGCCSAHTLPELTDGQSFHLA 209
gi 82174668   80 VGEMPGPRFGHTASVVYSRGKRACVLFGGRCYRPPGERTTETWNCVVDCPPQVFLIDLDFGCCSSHIVPELTDGQSFHVA 159
gi 75571634   82 VGDVPEPRYGHTISVVHNRGKRACVLFGGRSYRPPGERTTETWNSMVDCLPHVFLIDLEFGCCSAHIVPELTDGQSFHLA 161
gi 75570216  100 VGDIPEARYGHSISMVYSRGKCMAVIFGGRHYMPPGQRITESWNTAVDCFPQIFLIDLEFGCCKSYILPELQDGISFHVS 179
gi 75570214  100 AGDIPEPRYGHSINVVYSKGKSACVIFGGRSYLPPGQRTTETWNSVVDCMPEVFLVDLEFGCCTSYTLQEIQDGLSFHVS 179
gi 151335703 129 AGDVPEARYGHSMNVVFSKGKTAVVMFGGRSYVPLNQRTTENWNNVVDCEPLVYLIDLQFGCSTSFNLRELQDGISFHVS 208
gi 281182217  94 VGDIPEARYGHSMNVVYSRGKTAVVLFGGRSYIPLKQRTTEKWNSVTDCQPLVYLIDLQFGCSTAYTIKEIQDGLSFHVS 173
gi 86372047   81 VGDVPRARYGHTLSVIHSRGKTACVLFGGRSYMPPTERTTENWNSVVDCPPQVFLIDLEFGCCTAHTLPELTDGQSFHVA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75570215  181 IARNDTVYLLGGHTLESKSRPPRLYRLKVDLLLGSPVVGCSELPGGISVSSAIVAQTGA-NEYVILGGYESETQKRMTCN 259
gi 75570223  180 LSRKDCVYVLGGHTLASDSRPPRLFKLRVELLLGRPVISCDVLTGGISLSSAIVTQVGPeSEFVIMGGYESDSKKRLECN 259
gi 2498831   210 LARDDYVYFLGGQSLSLDFRPPRVYSLRDGVPEGKPAVSCSTWTPSMSISSAIATRVGPsHEFIILGGYQLETQKRMECS 289
gi 82174668  160 LARDDCIYMLGGHNLSSDTRPVRLLRIQVQLLLGGPVLSCDIMDNGLSLTSTITLKSGPgHEYVVLGGYQSEAQKRLECN 239
gi 75571634  162 LAREDRVYILGGHTMSSDSRPLRLFCLRVELLQGSPVISCNTLDGGLSLTSAIVVPSGLaHEYIILGGYQSETQKCLECS 241
gi 75570216  180 IARKDTVYFLGGCTLGSNSRSPNLYRLKVDLPLGSPAVSCTVIPGGISVSSGLVTQISS-DEFVIVGGYESENQKRVMCN 258
gi 75570214  180 VARNDTVYILGGHSLGNNVRSPNLYKLKIDLPLGSPDLKCTVLPGGLSLSSAIGTQTSN-NEFIIGGGYESNNQKCMICN 258
gi 151335703 209 LARNDTVYIFGGHSMGNNFRPPNVYKIKVDLPLGSPAVSCTVIHNKLSFSSSIVTQTSP-DEFVIVGGYESDSQKRFSCN 287
gi 281182217 174 ISRNDTVYIIGGHTLESNIRSPNIYRIKVDLPLGSPAMTCTVLQSQLPVSSAIVTHTCP-DEFLIVGGYESDSQKRMTCN 252
gi 86372047  161 LAREDCVYFLGGHILSSDCRPTRLIRLRLELLLGSPVLTCTVLHEGLSITSAIVAPIGY-HEYIVFGGYQSETQKRMECT 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75570215  260 TAVLDDTSIQVLERESPDWPGDIKLSKTWFGSSMGGGAVFLGIPGENKQITNE-SN-YFYRVNLIEDEE-----ITQTCS 332
gi 75570223  260 TVILDESGVHLTSRESPDWTSEIRQSKTWFGGSMEEGSVILGVPAEGKQFLSE-SN-YFYLVKFRQEEEd----PLQNCS 333
gi 2498831   290 SVVLDDSGINIEPREAPEWTGEIKHNHTWFGGSMGGGSALIGIPSEGRQATPE-AH-YFYQVCFQKEGEgkgedGNQVCS 367
gi 82174668  240 NVVLDDTGIHIEPRDPPPWTGEITHSRTWFGGSLGKGSALIGVPTEGRSAQPD-AH-NFYQVSFQMEGDgsgeeAMQGCS 317
gi 75571634  242 SVALDDAGIHIKPREPPAWTGEISHSRTWFGGSLGKGCALIGVPSEGRSALPE-TH-NFYQVSFKQDGNgemddGMQGCS 319
gi 75570216  259 TVIVDDNKIEILPRETPDWSTEIKLSKTWFGSNMGDGEVLIGIPGDNKHATTD-PY-YFCIIKFKEDED-----LMQNCS 331
gi 75570214  259 TLTLEDDRIKIQERETPDWTGDIKHSKVWFGSDMGNGAVLFGIPGDIKQLISD-TN-FFYILNFGTEEQ-----VMQHCS 331
gi 151335703 288 GIFLDNDTIDIQEIETPEWTGEIKHSKTWFGADMGKGAVLFGVPADNKHQSTDcSF-FFYVLNFG-DSDp----VVQTCS 361
gi 281182217 253 KISINNDNLDIQEMETPDWTGDVKQSKTWFGADMGHGVVLFGIPGDNKNHSSD-SNfYLYILNLGAEED-----LMQSCS 326
gi 86372047  240 YIGLDDVGVHMEPREPPQWTSEVTHSRTWFGGSLGKGSALIAIPSEGNPAPPD-AY-HFYWLSFQKEQDge--aPTQGCS 315
                        330       340
                 ....*....|....*....|....*
gi 75570215  333 QEST-EDQDDSTTFEDSEEFYIGCS 356
gi 75570223  334 QESTdQEQEDTAQLEDSEELYFSRE 358
gi 2498831   368 QEST--DFEDSAPLEDSEELYFGRE 390
gi 82174668  318 QEST--DFEDSAPLEDSEELYFGRE 340
gi 75571634  320 QEST--DFEDSAPLEDSEELYFSRE 342
gi 75570216  332 QEST-EDQEDSTTFEDSEEFYFSNG 355
gi 75570214  332 QTST-EDLEDSIPLEDSEEFYFNDD 355
gi 151335703 362 QGST-EELEDSMPLEDSEEFTFNRD 385
gi 281182217 327 QGSL-EEQEDSMPLEDSEEFVFCGD 350
gi 86372047  316 QEST--DFEDSAPLEDSEELYFGRE 338
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap