NCBI CDD Logo
?
smart00673: CARP 
Click on image for an interactive view with Cn3D
Domain in CAPs (cyclase-associated proteins) and X-linked retinitis pigmentosa 2 gene product.
Links
?
Statistics
?
PSSM-Id: 197827
View PSSM: smart00673
Aligned: 38 rows
Threshold Bit Score: 29.4081
Threshold Setting Gi: 19115122
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:

smart00673 is a member of the superfamily cl02725.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|....*...
2BX6_A        67 CENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRN 104
gi 8922517   375 CDNVKVIAV--CHRLSISSTTGCIFHVL-TPTRPLILS 409
gi 334186070 419 CERVHVIVA--AKRVCIANCRECVFFLG-VNQRPLIVG 453
gi 297798020 245 VEDCVLVLA--SHQIRIHCARKSDFYLR-VRSRPIIED 279
gi 24581582  234 LEDCTLSIA--CQQLRLHSSRSIRIYMH-VTCRAIIED 268
gi 26329573   65 CRDCKCTLA--CQQFRVRDCRKLEVFLC-CATQPIIES 99
gi 19115122  188 INDSTICVS--CHQFRLHHSTNLRVHLR-CKTSPVIEE 222
gi 297290847 456 CSDCVLAVA--CQQLRIHSTKDTRVFLQ-VTSRAIVED 490
gi 8922517   337 CNESFIYLLSPLRSVTIEKCRNSIFVLGPVGTTLHLHS 374
gi 334186070 381 CHDSVIYLLAPLRYATVHGCSDTTIVLGAVGKAIKVEH 418
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D