Conserved Protein Domain Family
HTH_ARAC

?
smart00342: HTH_ARAC 
Click on image for an interactive view with Cn3D
helix_turn_helix, arabinose operon control protein
Statistics
?
PSSM-Id: 197666
View PSSM: smart00342
Aligned: 136 rows
Threshold Bit Score: 64.1113
Threshold Setting Gi: 1176559
Created: 13-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

smart00342 is classified as a model that may span more than one domain.
smart00342 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1D5Y_A        19 PL-SLDNVAAKAGYSKWHLQRMFKDVTGHAIGAYIRARRLSKSAVALRLTARPILDIALQYRFDSQQTFTRAFKKQFAQT 97
gi 75539247  106 SL-SVDNVAHAVGMSARNFARVFRRDVGMTPADFVAVARIDAARRLLEDTTQPLQRIAASCGFADMNTMRRLFAKTIGVT 184
gi 81817380  177 PP-DLDGMAEQVGLSKYHLLRAFKKATGLSPRQWSMQLRTRRALGLLRRG-LAVGEVAHALGFADQSHLTRYFTSAYGIS 254
gi 81817364   24 PL-DVPALARVALMSAGHFSRSFRAAYGETPYSYLMTRRIERAMALLRRGDMSVTEVCFAVGCTSLGSFSSRFTELVGES 102
gi 81308983  188 PL-TLELLARHAAVSARTFSRRFAEDTGYTPMQWVMRARVDLARELLERSERSVEQIAADVGLGTGSNLRLHFQRILGTT 266
gi 81818252  172 AH-RIGELAQRAAMSPRHFTRVFSDEVGEAPGRYVERIRTEAARRQLEETHDTVVAIAARCGFGTAETMRRSFIRRVGIS 250
gi 81816850  172 QR-TLTGWATVLGCSERTLTRAFRTETGTSFARWVASVRAQHAVRLLARG-FEVEVVADAVGYRSASAFGAAFRRTTGTT 249
gi 323937048 169 EWgALGQWAGFFAMSERNLARLIVKETGLSFRQWRQQLQLIMALQGLVKG-DTVQKVAHTLGYDSTTAFITMFKKGLGQT 247
gi 256784813 187 PP-SLERLAGELGSSPFALLRAFRDAYGMPPHTWLTDARVRRARRLLDAG-TSPAEAAVAVGFTDQPHLNRHFARIVGVP 264
gi 145189     99 PV-TLEALADQVAMSPFHLHRLFKATTGMTPKAWQQRWRARRLRESLAKGE-SVTTSILNAGFPDSSSYYRKADETLGMT 176

                 ....*
1D5Y_A        98 PALYR 102
gi 75539247  185 PAAYR 189
gi 81817380  255 PGRYQ 259
gi 81817364  103 PSAYR 107
gi 81308983  267 PSEYR 271
gi 81818252  251 PDQYR 255
gi 81816850  250 PGRFR 254
gi 323937048 248 PGRYI 252
gi 256784813 265 PGSYQ 269
gi 145189    177 AKQFR 181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D