NCBI CDD Logo
?
pfam08638: Med14 
Mediator complex subunit MED14
Saccharomyces cerevisiae RGR1 mediator complex subunit affects chromatin structure, transcriptional regulation of diverse genes and sporulation, required for glucose repression, HO repression, RME1 repression and sporulation. This subunit is also found in higher eukaryotes and Med14 is the agreed unified nomenclature for this subunit. Med14 is found in the tail region of Mediator.
Links
?
Statistics
?
PSSM-Id: 192107
View PSSM: pfam08638
Aligned: 29 rows
Threshold Bit Score: 209.381
Threshold Setting Gi: 75207288
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:

pfam08638 is a member of the superfamily cl07312.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121790463   78 DVMPLSLLLSRLAQFSHLKLQELILDLASkplpentlngnakgsmnssingnvnagvngvpklpspalEDTSPESLNKKT 157
gi 74698823    94 DLISLAALVERLANFGYEALQNLAETLPS-------------------------------------------LPSSSKRA 130
gi 75207288     7 QTVDFSALVGRAAEESFLSFKELVDKSKS-----------------------------------------TELSDTEKKV 45
gi 158518536  103 PTIPLNVLLDFAIQHVYHEITVLAELMQR---------------------------------------KTNDQGEQERKM 143
gi 223590085   29 NTMSMSMLIDFIIQRTYHELTVLAELLPR-------------------------------------------KTDMERKI 65
gi 158564126   27 NLIPLGRLIDFIIQRTYHELTVLAELLPR-------------------------------------------KTDMERKI 63
gi 26398152    12 GFYPLPEIVETFSHHVLQELVSLAEVLPS-------------------------------------------MSNVEKKK 48
gi 218511682   92 NIIPLSNVLKFYTQEAYKQLTTAIENLSS---------------------------------------TKDTENDSSRKK 132
gi 158513720   61 NVIPLSNVLKFYTQEAFKQITTLVENLAS---------------------------------------TKDSEDDSVRKK 101
gi 156367233    9 NKINLSMLIDFLLQKTYHELTVLSELLPR-------------------------------------------KPDIERKI 45
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121790463  158 MILKFIQDLHSRWVKALVITEWARNADEVGKLIDLRTHLAAKLELYNRAFWNMVNL-KHEMAFAKVPSPDLKTALEVLST 236
gi 74698823   131 KIFNTALNVRKQFIKLLVLARWSKDISDLQKSRNIIALLSEQQWQHEDVFAGLTDI-RKILPNARMRNADLPTAIDVLHT 209
gi 75207288    46 SLLKYVAKTQQRMLRLNALAKWCKQVPLINYFQDLGSTLSAHDICFTQAADSLFFM-HEGLQQARAPVYDVPSAVEILLT 124
gi 158518536  144 SLVHFAHATRSQFLKLVALVKWIRISKRMDVCYSIDYLLDLQSQYFIDTADRLVAMtRGDLELARLPEYHIAPAIDVLVL 223
gi 223590085   66 EIYNYAARTRHLFTRLNALVKWGNSVSKVDKSSQIMSFLDKQNMLFVETADMLARMsRETLVRARLPNFHIPAAVEVLTT 145
gi 158564126   64 EIYNFSASTRQLFIRLLALVKWANSASKVDKSAKIMAFLDKQSLLFMDTADMLSRMaRETLVNARLPNFHIPAAVEILTT 143
gi 26398152    49 KILDWLLRSRAFTMRLLVLARWVHLSPSVHRCIDVVAFLQGQKFCFQNLVHVLQDI-RYQLSFARLRNSDLVTALDILST 127
gi 218511682  133 FFLNLIISLRQDFIKIYTLVKWASSSKDISKLIDLLNWFRSQDFYFEQLGYGLNEL--NRYSGAKLPNSDIITSLEVFIK 210
gi 158513720  102 KFLELIIALRQDFIKIYTLVKWAANSKDVSRFIDLLNWLRMQEFYFDQLTFQLNAL--NGYSGAKLPNSDLITSLEVLFK 179
gi 156367233   46 EIVQFASRTRQQFVRLLALVKWAGGAKGVAKCQAISTFLDQQSMVFVDTADMLARMaRETLVQARLPTFCLPAAVDVLTT 125
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121790463  237 G---AVHWMPDFG--YLPKPPLTTQETLHWLNEIEVVLHMRLQ-LheYEQIPEPW-KEYKIDNGRVTFTVPGEFEVDLTI 309
gi 74698823   210 GtyrRLPASIKQM--AVAPKPFTDQQALLIVSRLEDALRTRMA-C--RELVPAPL-SNYTIHDGKVHFHVPGLFQAQLTA 283
gi 75207288   125 GsyqRLPKCLDD---VGMQSSLDEHQQKPALRKLEVLVRSKLL----EITLPKEI-TEVKISKGTVTLSVDGEFKVLVTL 196
gi 158518536  224 GtynRMPSKIKEA--FIPPAKITPREQKLVTSRLNQLIESRLSrL--SSGIPPNI-KEIHINNGLATLLVPGEFEIKITL 298
gi 223590085  146 GtynRLPTCIRER--IVPADAITPAEKKQTLLRLNQVIQHRLV----TGKLLPQM-REFRIKNGRVTFEVKHEFSVALTV 218
gi 158564126  144 GtysRLPSIIRER--IVPPDPITTLEKRQTLQRLNQVIQHRLV----TGNLLPQL-RKFKIENGRVTFKVDHEFEVSLTV 216
gi 26398152   128 GtslRLANAPTSKlyMLSESPLSTKQILQTLHALNMLIRIRLS-L--YEIIPTPF-QHFTIANGRCTFTVPNEFSVSLTT 203
gi 218511682  211 K----RPQLPSYN--LISTPPISSEKTLEVLKDLNLTLMTRMA-L--INNLPKRFiNNYEIRDGRVYFTIQNEFQVSVTV 281
gi 158513720  180 G----RPQLPSYN--YIKIPKISPEKTLEVMQDLNLILMTRIA-L--I-DIPKRFiNNYVIKDGRIYFSVPNEFQVSITV 249
gi 156367233  126 GtyqRLPTCIRDK--IVPPDPLSLSEKNKTLQRLNEVIQHRLV-L---ARIPPQM-ASLKIADGCVTFHVDNEFEVSLTL 198

                  ....
gi 121790463  310 SDED 313
gi 74698823   284 SGSA 287
gi 75207288   197 GYRG 200
gi 158518536  299 LGET 302
gi 223590085  219 MGDS 222
gi 158564126  217 MGDG 220
gi 26398152   204 NSQD 207
gi 218511682  282 GNDL 285
gi 158513720  250 ANDM 253
gi 156367233  199 MGDD 202
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap