Conserved Protein Domain Family
PDH_E1_alph_y

?
TIGR03182: PDH_E1_alph_y 
Click on image for an interactive view with Cn3D
pyruvate dehydrogenase E1 component, alpha subunit
Members of this protein family are the alpha subunit of the E1 component of pyruvate dehydrogenase (PDH). This model represents one branch of a larger family that E1-alpha proteins from 2-oxoisovalerate dehydrogenase, acetoin dehydrogenase, another PDH clade, etc [Energy metabolism, Pyruvate dehydrogenase].
Statistics
?
PSSM-Id: 188297
View PSSM: TIGR03182
Aligned: 35 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 11-Sep-2012
Updated: 15-Oct-2012
Structure
?
Program:
Drawing:
Aligned Rows:
TIGR03182 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3EXE_A        50 REDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPT-DHLITAYRAHGFTFTRGLSVREILA 128
gi 37521098   17 RPEALVLYRDMVLGRTFEDTCAQMYYRGKMFGFVHLYNGQEAVSTGVIKAMRPD-DYVTSTYRDHVHALSKGVPARSVMA 95
gi 17230200   19 KEEGLLLYEDMTLGRFFEDKCAEMYYRGKMFGFVHLYNGQEAVSTGVIQAMRPGeDFVSSTYRDHVHALSAGVPAREVMA 98
gi 33861844   21 RETGLFLYEDMTLGRRFEDKCAEMYYRGKMFGFVHLYNGQEAISTGVIGAMKRKhDWFCSTYRDHVHALSAGVPSFEVMS 100
gi 116669076  14 SDHARHLLRQMLRVRRLEEQCVELYSAAKIRGFLHVYIGEEAVAAGVMSTLAPD-DAVVATYREHGHALLRGVPAGAILA 92
gi 51245948   16 PAHARQLLYQMVRIRRFEEKAAELYTKMKIRGFLHLYIGEEAVAAGVSAALEPE-DASVGTYREHGNALARGISAGAIMA 94
gi 89899201   15 KPFALSLLSDMLRIRRMEERAAELYGQQKIRGFLHLYIGEEAVAAGALRALSAD-DKVVATYREHGHALLHGLKMDTIMA 93
gi 46447367   23 PQALIECFQQMLKIRNFELRAESAYQQGKIGGFFHAYVGQEAIQTAAVQAIGQS-NWYATSYRCHALALLLGATPNELMA 101
gi 50921411   75 REEALELYEDMVLGRIFEDMCAQMYYRGKMFGFVHLYNGQEAVSTGFIKLLNQA-DCVVSTYRDHVHALSKGVPARSVMA 153
gi 83717680   20 KDFALVLLRDMLRVRRLEETCAQLYGAGKIRGFLHLYIGEEAAGIGALHALEPD-DNVVATYREHAHALVRGMDMGVLMA 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3EXE_A       129 ELTGRKGGCAKGKGGSMHMYA--KNFYGGNGIVGAQVPLGAGIALACKYN-------GK-------D--EVCLTLYGDGA 190
gi 37521098   96 ELFGKATGCSKGRGGSMHLFSaeHNLLGGFAFVAEGIPIATGAGFTAVYK-------GT-------D--QVSACFFGDGA 159
gi 17230200   99 ELFGKATGCSKGRGGSMHMFSaeHGLLGGYAFVAEGIPVAAGAAFQSKYRrevlgdpNA-------D--QVTACFFGDGA 169
gi 33861844  101 ELFGKATGCSKGRGGSMHLFSkeHHLLGGYAFIGEGIPVALGSAFSSKYK-------KEvvgdnqsD--SVTAAFFGDGT 171
gi 116669076  93 EMYGHVEGCCRGRGGSMHLFDagTRFYGGNAIVAGGLPLAVGLALADKMS-------GR-------S--RVTVCFFGEGA 156
gi 51245948   95 EMYGKQEGCSRGRGGSMHIFDdkTRFYGGNAIVGGGLPLAVGLALADKMQ-------GK-------K--RVTCCFFGDGA 158
gi 89899201   94 EMFGRQDGCSRGRGGSMHLFDraHHFFGGQAIVGGGLPLATGLALADKLL-------KR-------R--ALTACFFGEGA 157
gi 46447367  102 ELYGRATGNAKGRGGSMHFFT--DRLLGGFGIVTGQVPIATGAAFALKYK-------GNk------N--EVAVCFMGDGA 164
gi 50921411  154 ELFGKATGCCRGQGGSMHMFSepHNLLGGFAFIGEGIPVATGAAFAAKYRhevlkqsSP-------DglDVTLAFFGDGT 226
gi 83717680   99 EMFGKREGCARGRGGSMHLFDrqTRLFGGNAIVGGGLPLAAGLALAEKMQ-------AG-------K--RVTACFFGDGA 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3EXE_A       191 ANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYK-RGDF--IPGLRVDGMDILCVREATRFAAAYCRS 267
gi 37521098  160 TNNGQFFECLNMAALWNLPVLYVVENNLWSIGMYHHRASSVIEIYK-KADAfgIPGVRVDGMDVLAVRAVAKEAIERARA 238
gi 17230200  170 ANNGQFFETLNMAALWKLPIIFVVENNKWAIGMAHDRATSDPEIYK-KASVfnMVGVEVDGMDVLAVRAVAQEAVARARA 248
gi 33861844  172 CNNGQFFECLNMAQLWKLPIIFVVENNKWAIGMAHDRATSNPEIWR-KASAfgMHGEEVDGMDVLAVRGAAQRAVERARA 250
gi 116669076 157 VAEGAFHESLNLAALWQLPVLFCCENNLYAMGTALARSESQTDIAL-KAAGyeIASWSADGMDVIAVEEAARRAVDAVRA 235
gi 51245948  159 VSEGEFHESMNLAALWNLPVLFICENNLYAMGTALERSQSVTDLTR-KAVSyrIAASAVDGMDVLAVEAAANEAVNAVRS 237
gi 89899201  158 VAEGAFHEAMNLAALWRLPVLFCCENNLYAMGTALARSESQTDLCL-KAASygMEVMTVDGMDVVAVHEAVRFAAQKVRE 236
gi 46447367  165 VPQGSFHESLNLASLWNLPCIYVIENNQWGMGTAIQKAVSVKRLAEdKASGynMKAYTLDGMDFFNCYGGFAQIHQEVLQ 244
gi 50921411  227 CNNGQFFECLNMAQLWKLPIVFVVENNLWAIGMSHLRATSDPEIYK-KGPAfgMPGVHVDGMDVLKVREVAKEAIERARR 305
gi 83717680  163 VAEGVFHESMNLAALWRLPVLFCCENNLYAMGTALERSESQTDLCA-KAASygMRVSSADGMDVVAVHDAAKDAVEYVRG 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3EXE_A       268 GKGPILMELQTYRYHGHSMSDPGvSYRTREEIQEVRsKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATA 347
gi 37521098  239 GGGPTLIECTTYRFRGHSLADPD-ELRDPAEKEFWR-KQDPIPRLAAFVREQELASAEELKAIDQEIRAEIDDAVLFAEE 316
gi 17230200  249 GEGPTLIEALTYRFRGHSLADPD-EMRSKAEKEFWF-SRDPIKKLAAYLIEQNLADEAELKAIERKIQDVIDDAVKFAES 326
gi 33861844  251 GEGPTLLECLTYRFRGHSLADPD-ELRAEEEKEFWA-KRDPIKKLANQIIEGNFAQEEELKSIEKKIDLEISESVKNALD 328
gi 116669076 236 GGGPHFLELRTYRFRAHSMFDPE-RYRDKAEVSRWM-ERDPIDTLRTALEAAGQLSAKDWKSIQQDVDTEVDAAVEFAEA 313
gi 51245948  238 GQKPYFLECRTYRFRAHSMFDPE-LYRSKAEVDKWK-KRCPIDSFVKRLKKQDLLSDGDMEKLERQVAREIEEAVAFAEN 315
gi 89899201  237 ASAPMFVELRTYRFRAHSMFDPD-LYRAKQEIEAWK-TRGPVHTFTARLKLQGILSEDEFLALDASAQAEVEAAVAFAEG 314
gi 46447367  245 RQRPVLVEVVTERFKGHSISDPG-LYRAKDTLKQIM-AKDPILALQAVLIKKGILTEDMVKQMNKENREKIIEAMSFAEN 322
gi 50921411  306 GEGPTLVECETYRFRGHSLADPD-ELRRPDEKSHYA-ARDPITALKKYIIEQNLATESELKSIEKKIDDVVEEAVEFADA 383
gi 83717680  242 GAGPMFVELRTYRFRAHSMYDAE-LYRQKAEVDEWK-ARGPIHTFTARLKAEGKLTEDEFAALDADANAEVARAVAFAEA 319
                        330
                 ....*....|....*
3EXE_A       348 DPEPPLEELGYHIYS 362
gi 37521098  317 SPEPPIDELYRFQFA 331
gi 17230200  327 SPEPDPSELYRFVFA 341
gi 33861844  329 APEPPSNELTKYIWA 343
gi 116669076 314 GTPEPLEDLTRFVYS 328
gi 51245948  316 GTWEPVEDLTRFVYS 330
gi 89899201  315 SNWEPVEDLLRDVHT 329
gi 46447367  323 SPWPDPQTLEEDVFA 337
gi 50921411  384 SPLPPRSQLLENVFS 398
gi 83717680  320 GEWERVEDLAKDVYT 334
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D