Conserved Protein Domain Family
2a30

?
TIGR00930: 2a30 
K-Cl cotransporter
[Transport and binding proteins, Other].
Statistics
?
PSSM-Id: 188096
View PSSM: TIGR00930
Aligned: 18 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 11-Sep-2012
Updated: 15-Oct-2012
Structure
?
Aligned Rows:
TIGR00930 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709294   188 NTIDAVPRIDHYRHTVAQLGEKLIRPSLAELHDEL--DK-----EPFEDGYVNGEESSP---AEEAVSKHVAdNKGVVKF 257
gi 1079517   100 NTMDAVPKIEYYRNTGSVSGPKVNRPSLLEIHEQL--AKnvtvaPGSADRVANGDGMPG---DEQAENKEED-MTGVVKF 173
gi 1709296   103 NTMDAVPKIEYYRNTGSVSGPKVNRPSLLEIHEQL--AKnvavtPGSADRVANGEGMPG---EEHAENKEEDnKAGAVKF 177
gi 2500792    67 LTREALPRMENYRNSK----RALKRPSLGELHG--------------DHLITEEDEKDQ-----NHRDTKSPtPAVGIKL 123
gi 27151684   42 NHRESSPFLCPLEASRGSDYYDRNLALFEEELDIR--PKvssllGKLVSYTNLTQGAKEheeAESGEGTRRRa-AKAPSM 118
gi 2599467    42 NQKESSPFLCPMEASRGNDYCDRNLALFEEELDIR--PKvssllGKLVSYTNLTQGAKEheeAESGEGTRRRa-AKAPSM 118
gi 1403707    42 NHRENSPFLSPLDASRGNDYYDRNLALFEEELDIR--PKvssllGKLVSYTNLTQGAKEheeAESGEGGRRRa-AKAPSM 118
gi 4585229    58 HKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTR--PKvssllNRMANYTNLTQGAKEheeAENITEGKKKp-TKTPQM 134
gi 1403709    21 NPKESSPFINSTDTEKGREYDGRNMALFEEEMDTS--PMvssllSGLANYTNLPQGSKEheeAENNEGGKKKp-VQAPRM 97
gi 2582381    68 VKVGVQPNMASEEREESAANHNINGPQRESKLELFgfDSlvnilGLKSMTGDQIQAPSSprdGEDVTITFEQpKPTADKS 147
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709294   258 GWIKGVLVRCMLNIWGVMLFIRLSWIVGHAGIGLALLVIGTATVVTTITGLSTSAITTNGFVRGGGAYYLISRSLGPEFG 337
gi 1079517   174 GWVKGVLVRCMLNIWGVMLFIRLSWIVGEAGIGLGVLIILLSTMVTSITGLSTSAIATNGFVRGGGAYYLISRSLGPEFG 253
gi 1709296   178 GWVKGVLVRCMLNIWGVMLFIRLSWIVGEAGIGLGVVIILLSTMVTSITGLSTSAIATNGFVRGGGAYYLISRSLGPEFG 257
gi 2500792   124 GWIQGVFIPCLLNIWGVMLFLRLSWVVSQAGIGLSLVIIAISAIVCVITTLSMSAICTNGEVKGGGIYYIISRSLGPEFG 203
gi 27151684  119 GTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFG 198
gi 2599467   119 GTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFG 198
gi 1403707   119 GTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFG 198
gi 4585229   135 GTFMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFG 214
gi 1403709    98 GTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFG 177
gi 2582381   148 GTWMGVFMPCLQNILGIIYYIRFSWIVGMAGIGESLLLVVFCGSCTFLTTVSLSAIASNGAMKGGGPYYLIGRALGPEVG 227
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709294   338 GAIGLIFAFANAVAVAMYVVGFAETVRD-------LLVE---------HNA-LMIDEMSDIRIIGSVTIVVLFGISVAGM 400
gi 1079517   254 GSIGLIFAFANAVAVAMYVVGFAETVVD-------LLKE---------SDS-MMVDPTNDIRIIGSITVVILLGISVAGM 316
gi 1709296   258 GSIGLIFAFANAVAVAMYVVGFAETVVD-------LLKE---------SDS-MMVDPTNDIRIIGSITVVILLGISVAGM 320
gi 2500792   204 ASVGIIFAFANAVAASMNTIGFCDSLND-------LLRS---------NGLkITEDPINDVRIVGTVALLVMCIICAIGM 267
gi 27151684  199 GAVGLCFYLGTTFAAAMYILGAIEILLTyiappaaIFYPs--------GTHdTSNATLNNMRVYGTVFLSFMTLVVFVGV 270
gi 2599467   199 GAVGLCFYLGTTFAAAMYILGAIEILLTyiappaaIFYPt--------GTHdTSSATLNNMRVYGTIFLTFMTLVVFVGV 270
gi 1403707   199 GAVGLCFYLGTTFAAAMYILGAIEILLTyiappaaIFYPs--------GTHdMSSATLNNMRVYGTIFLTFMTLVVFVGV 270
gi 4585229   215 GAVGLCFYLGTTFAAAMYILGAIEIFLVyivpraaIFHSd--------DALkESAAMLNNMRVYGTAFLVLMVLVVFIGV 286
gi 1403709   178 GAVGLCFYLGTTFAGAMYILGTIEILLAylfpamaIFKAe--------DASgEAAAMLNNMRVYGTCVLTCMATVVFVGV 249
gi 2582381   228 VSIGLCFFLGNAIAGAMYVLGAVETFLNavp-sagIFREtitrvngtdIAEpITSPSLHDLQIYGIVVSILLCFVVFGGV 306
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709294   401 EWEAKAQIVLLGILLLAIVNFTVGTFIPAND--KRAKGFFNYRGEIFSEN------------------------------ 448
gi 1079517   317 EWEAKAQVILLVILLIAIANFFIGTVIPSNNe-KKSRGFFNYQASIFAEN------------------------------ 365
gi 1709296   321 EWEAKAQVILLIILLIAIANFFIGTVIPSNNe-KKSRGFFNYQASIFAEN------------------------------ 369
gi 2500792   268 DWESKAQNFLIAIIVGAMVDFVVGTIMGPKDnsEIAKGFVGLSSATFVEN------------------------------ 317
gi 27151684  271 KYVNKFASLFLACVIISILSIYAGGIKSMFD--PPVFPVCMLGNRTLSRDqfdicakttmvdnetvatrlwsffchspnl 348
gi 2599467   271 KYVNKFASLFLACVIISILSIYAGGIKSIFD--PPVFPVCMLGNRTLSRDqfdvcaktvmvdnetvttrlwslfchspnl 348
gi 1403707   271 KYVNKFASLFLACVIISILSIYVGGIKSAFD--PPVFPVCMLGNRTLSRDqfdicaktvvvdnetvatrlwtffchspnl 348
gi 4585229   287 RYVNKFASLFLACVIVSILAIYAGAIKSSFA--PPHFPVCMLGNRTLSSRhidvcsktkeinnmtvpsklwgffcnssqf 364
gi 1403709   250 KYVNKFALVFLGCVILSILAIYAGVIKSAFD--PPNFPICLLGNRTLSRHgfdvcaklawegnetvttrlwg-lfcssrl 326
gi 2582381   307 KMINRVAPAFLVPVLFSLLCIFVGIFSARHD--RPAVGITGLNLESFKNNwgss-------------------------- 358
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709294   449 ---------------FVPDFRDGED------------------------------------------------FFSVFAI 465
gi 1079517   366 ---------------FGPSFTKGEG------------------------------------------------FFSVFAI 382
gi 1709296   370 ---------------FGPSFTKGEG------------------------------------------------FFSVFAI 386
gi 2500792   318 ---------------FKSDFRFSEKld--------------------------------------------qnFFSVFAI 338
gi 27151684  349 ttdscdpyfllnnvtEIPGIPGAAAgvlqenlwsaylekgevvekrgl--pstdavglkenlplyvvadiatsFTVLVGI 426
gi 2599467   349 tadscdpyfllnnvtEIPGIPGAAAsvlqenlwsaylekgevvekhgl--pstdalglkeslplyvvadiatsFTVLVGI 426
gi 1403707   349 tadscdpyfllnnvtEIPGIPGAAAgvlqenlwsaylekgevvekhgl--pstdtlglkeslslyvvadiatsFTVLVGI 426
gi 4585229   365 fnatcdeyfvhnnvtSIQGIPGLASgiitenlwsnylpkgeiiekps----akssdvlgslnheyvlvdittsFTLLVGI 440
gi 1403709   327 lnatcdeyftrnnvtEIQGIPGAASglikenlwssyltkgviverrgmpsvgladgtpvdmdhpyvfsdmtsyFTLLVGI 406
gi 2582381   359 -----------yqmtNNAGIPDPNGkiyw-------------------------------------------dfnALVGL 384
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709294   466 FFPAATGILAGANISGDLADPQLAIPKGTLLAILITTIVYAGAAVSVGSCIVREATGNLTDAIIPgtvtNCTNVACklgf 545
gi 1079517   383 FFPAATGILAGANISGDLEDPQDAIPRGTMLAIFITTVAYIGVAICVAACVVRDATGSMNDTIVSgm-nCNGSAACglgy 461
gi 1709296   387 FFPAATGILAGANISGDLEDPQDAIPRGTMLAIFITTVAYIGVAICVGACVVRDATGSMNDTIISgi-nCNGSAACglgy 465
gi 2500792   339 FFPSVTGIQAGANISGDLKDPASAIPKGTLLALLISMVSYTLMVLFAGGGALRDASGNITDLLIVn--gTVTDYSS---- 412
gi 27151684  427 FFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIVTTSLVYFSSVVLFGACIEGVVLRDKYGDGVS--------------- 491
gi 2599467   427 FFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIITTSLVYFSSVVLFGACIEGVVLRDKYGDGVS--------------- 491
gi 1403707   427 FFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIVTTSLVYFSSVILFGACIEGVVLRDKYGDGVS--------------- 491
gi 4585229   441 FFPSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVK--------------- 505
gi 1403709   407 YFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACIEGVVLRDKFGEAVN--------------- 471
gi 2582381   385 FFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTGLYVVSVLLFGAVST-------RDKLLT--------------- 442
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709294   546 nFSSCATN-KCSYGLMNDFQVMSLVSGFGPLITAGIFSATLSSALASLVSAPKIFQALCKDNIYPGLHVFSVGYGKNNEP 624
gi 1079517   462 dFSRCQHE-PCQYGLMNNFQVMSMVSGFGPLITAGIFSATLSSALASLVSAPKVFQALCKDNIFKGLQFFAKGYGKNNEP 540
gi 1709296   466 dFSRCRHE-PCQYGLMNNFQVMSMVSGFGPLITAGIFSATLSSALASLVSAAKVFQALCKDNIYKALQFFAKGYGKNNEP 544
gi 2500792   413 -VSLCALNnTCEYGLHNSYSVMQLMSAWGPFIYGGCWAATLSTALTNLLSVPRLIQALGVDRIYPGLIFFSKPYGRHGEP 491
gi 27151684  492 ----------------RNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKAN-GEP 554
gi 2599467   492 ----------------RNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKAN-GEP 554
gi 1403707   492 ----------------RNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKAN-GEP 554
gi 4585229   506 ----------------GNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKAN-GEP 568
gi 1403709   472 ----------------GNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDGIVPFLQVFGHGKAN-GEP 534
gi 2582381   443 ----------------DRLLSATVAWPLPAIVYVGIILSTLGAALQSLTGAPRLLAAIANDDILPVLNYFKVADG--HEP 504
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709294   625 LRGYVLTFFIGLGFILIAELNVIAPIISNFFLASYALINFSVFHASLAKSPGWRPAFRFYNMWISLIGAILCCGVMFVIN 704
gi 1079517   541 LRGYFLTFVIAMAFILIAELNVIAPIISNFFLASYALINFSCFHASYAKSPGWRPAYGTYNMWVSLFGAILCCAVMFVIN 620
gi 1709296   545 LRGYILTFVIAMAFILIAELNTIAPIISNFFLASYALINFSCFHASYAKSPGWRPAYGIYNMWVSLFGAVLCCAVMFVIN 624
gi 2500792   492 YRGYVLTFFVSLLFLLIADLNTIAPLISNFYLASYALINFCTFHRALVRPLGWRPTFRYYNMWLSLAGFLMCVAIMLLVH 571
gi 27151684  555 TWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFVSS 634
gi 2599467   555 TWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFVSS 634
gi 1403707   555 TWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFVSS 634
gi 4585229   569 TWALLLTAAIAELGILIASLDLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISS 648
gi 1403709   535 TWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICS 614
gi 2582381   505 HVATLFTAFICIGCVVIGNLDLVSPTSTMFYLVCYAGVNLSSFLLDLLDAPSWRPRWKFHHWGLSLVGALLCIVIMFLIS 584
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709294   705 WWAALLTNVIVLALYIYVTYKKPDVNWGSSTQALTYLNALQHAIRLTGVEDHVKNFRPQCLLMTGAP-------TSRPAL 777
gi 1079517   621 WWAAVITYVIELFLYIYVTYKKPDVNWGSSTQALSYVSALDNALELTTVEDHVKNFRPQCIVLTGGP-------MTRPAL 693
gi 1709296   625 WWAAVITYVIEFFLYIYVTYKKPDVNWGSSTQALSYVSALDNALELTTVEDHVKNFRPQCFVLTGGP-------MTRPAL 697
gi 2500792   572 WVMSLVTFAIFFTLYLIVHYRRPDVNWGSSTQAQMYKTALSSAHALARTGEHVKNYWPQLLVLAGRP-------QARPAL 644
gi 27151684  635 WYYALVAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDed---lhVKYPRL 711
gi 2599467   635 WYYALVAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDed---lhVKYPRL 711
gi 1403707   635 WYYALVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDed---lhVKYPRL 711
gi 4585229   649 WYYAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDed---lhVKHPRL 725
gi 1403709   615 WYYALVAMLIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDqd---qnVVHPQL 691
gi 2582381   585 WAFTIVSLALASLIYYYVSIKGKAGDWGDGFKSAYFQLALRSLRSLGANQVHPKNWYPIPLVFCRPWgklpenvPCHPKL 664
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709294   778 LHLVHAFT-KNVGLVVCGHVHTGPRRQALKEISTDQAKYQRWLIKNKMKAFYAPVYAEDLREGTQFLLQAVGLGRMRPNT 856
gi 1079517   694 LDITHAFT-KNSGLCICCEVFVGPRKLCVKEMNSGMAKKQAWLIKNKIKAFYAAVAADCFRDGVRSLLQASGLGRMKPNT 772
gi 1709296   698 LDITYAFT-KNSGLCICCEVFVGPRKLCVKEMNSGMAKKQAWLIKNKIKAFYAAVAADCFRDGVRSLLQASGLGRMKPNT 776
gi 2500792   645 VDLGNLIS-KAGSLMIVGDISQEKLSYKVR--SARARSDDEWLRGRKVRAFCSRVHGFSFEPGARALVQGSGVGRLAPNV 721
gi 27151684  712 LTFASQLK-AGKGLTIVGSVIQGSFLESYGEAQAAEQTIKNMMKIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNS 790
gi 2599467   712 LTFASQLK-AGKGLTIVGSVIQGSFLESYGEAQAAEQTIKNMMEIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNS 790
gi 1403707   712 LTFASQLK-AGKGLTIVGSVIQGSFLESYGEAQAAEQTIKNMMEIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNS 790
gi 4585229   726 LTFASQLK-AGKGLTIVGSVIVGNFLENYGEALAAEQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKHNT 804
gi 1403709   692 LSLTSQLK-AGKGLTIVGSVLEGTFLDNHPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHLIQSGGLGGLQHNT 770
gi 2582381   665 ADFANCMKkKGRGMSIFVSIIDGDYHERAEDAKAACEQLSTYIEYKQCEGVAEIVVAPNMSEGFRGIVQTMGLGNLKPNI 744
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709294   857 LVFGFKKDWRQAL-MKDVENYINAIHDAFDYQYGVVVIRLKEGFNIS-HLQAQEEL---------Ctsqeksahpkdivv 925
gi 1079517   773 PVIGYKKNWRKAP-LSELENYVGIIHDAFDFEIGVVIVRISQGFDISpVLQVQDEL---------Ekleqerlaleaaik 842
gi 1709296   777 LVIGYKKKWRKAP-LTEIENYVGIIHDAFDFEIGVVIVRISQGFDISqVLQVQEEL---------Ekleqerlaleatik 846
gi 2500792   722 LLMGYKSDWTTCP-ANDLVSYFNVLHTAFENRLAVAIVRVSGGLDYSaVVSEGAEEgaagsltatSssgelrvrrdglim 800
gi 27151684  791 VVLGWPYGWRQSEdPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSN--------------------------------- 837
gi 2599467   791 VVLGWPYGWRQSEdPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSN--------------------------------- 837
gi 1403707   791 VVLGWPYGWRQSEdPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSN--------------------------------- 837
gi 4585229   805 VVMGWPNGWRQSEdARAWKTFIGTVRVTTAAHLALLVAKNISFFPSN--------------------------------- 851
gi 1403709   771 VLVGWPRNWRQKEdHQTWRNFIELVRETTAGHLALLVTKNVSMFPGN--------------------------------- 817
gi 2582381   745 IVMRYPEIWRRENlTDIPATFVGIINDCIVANKAVVIVKGLDEWPNE--------------------------------- 791
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709294   926 nLEHSDAd-SSkpssksvsETNspavcqd----qkdeedDGKASTQPLLKkevkdpsvpLnmtdqkllQASSQFQKKQGK 1000
gi 1079517   843 dNECEEGkgGIrglfkkagKLNitkp---------apkkDGNISSIQSMH---------VgefnqklvEASAQFKKKQGK 904
gi 1709296   847 dNECEEGngGIrglfkkvgKLNitkp---------tpkkDSSINTIQSMH---------VgefnqklvEASTQFKKKQGK 908
gi 2500792   801 hADSDLDirDTqpkhnlsnLLTlttsrsftiseckekdkKKKERKPNDMHrqivyntasGlelskfqlAQMSLFQKKQES 880
gi 27151684  838 -------------------------------------------------------------------------H-ERYLE 843
gi 2599467   838 -------------------------------------------------------------------------H-ERYLE 843
gi 1403707   838 -------------------------------------------------------------------------H-ERYLE 843
gi 4585229   852 -------------------------------------------------------------------------V-EQFSE 857
gi 1403709   818 -------------------------------------------------------------------------P-ERFSE 823
gi 2582381   792 -------------------------------------------------------------------------Y-QRQY- 796
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709294  1001 GTIDVWWLFDDGGLTLLIPYLLTTKKKWKDCKIRVFIGG-KINRIDHDRRTMATLLSKFRIDFSDITVLG---DMNTK-- 1074
gi 1079517   905 GTIDVWWLFDDGGLTLLIPYILTLRKKWKDCKLRIYVGG-KITRIEEEKISMASLLSKFRIKFADIHIIG---DINIK-- 978
gi 1709296   909 GTIDVWWLFDDGGLTLLIPYILTLRKKWKDCKLRIYVGG-KINRIEEEKIAMASLLSKFRIKFADIHVIG---DINIK-- 982
gi 2500792   881 GTLDVWWLYDDGGLTILLPYIISQRSAWANCKLRIFALAnRLHEMELEERNMANLLAKFRIDYSSLTMVQ---DITDP-- 955
gi 27151684  844 GHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCRMRIFTVAqMDDNSIQMKKDLAVFLYHLRLEAEVEVVEMhnsDISAYty 923
gi 2599467   844 GHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCRMRIFTVAqMDDNSIQMKKDLAIFLYHLRLEAEVEVVEMpnsDISAYty 923
gi 1403707   844 GHIDVWWIVHDGGMLMLLPFLLRQHKVWKKCRMRIFTVAqMDDNSIQMKKDLAIFLYHLRLEAEVEVVEMhnsDISAYty 923
gi 4585229   858 GNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCSIRIFTVAqLEDNSIQMKKDLATFLYHLRIEAEVEVVEMhdsDISAYty 937
gi 1403709   824 GSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAqMDDNSIQMKKDLTTFLYHLRITAEVEVVEMhesDISAYty 903
gi 2582381   797 GTIDLYWIVRDGGLMLLLSQLLLTKDSFEGCKIQVFCIAeEDSDAEGLKADVKKFLYDLRMQAEVIVISMkswEAQGE-- 874
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709294  1075 PSKDNITAFEEMIEPFRLHEDDKEQEA---SE------------------------------------------------ 1103
gi 1079517   979 PNKESWKVFEEMIEPYRLHESHKDLTT---AE------------------------------------------------ 1007
gi 1709296   983 PNKESWKFFEEMIEPYRLHESCKDLTT---AE------------------------------------------------ 1011
gi 2500792   956 PQPETKALFDETIKKFTEESAS--------PD------------------------------------------------ 979
gi 27151684  924 ERTLMMEQRSQMLRQMRLTKTEREREAqlvKDrhsalrleslysd----------------------------------- 968
gi 2599467   924 ERTLMMEQRSQMLRQMRLTKTEREREAqlvKDrhsalrleslysd----------------------------------- 968
gi 1403707   924 ERTLMMEQRSQMLRQMRLTKTERDREAqlvKDrhsalrleslysd----------------------------------- 968
gi 4585229   938 ERTLMMEQRSQMLRHMRLSKTERDREAqlvKDrnsmlrltsigsd----------------------------------- 982
gi 1403709   904 EKTLVMEQRSQILKQMHLTKNEREREIqsiTDesrgsirrknpantrlrlnvpeetacdneekpeeevqlihdqsapscp 983
gi 2582381   875 -QQESVEAFSAAQQRVASYLEEMKEQArrdGTp----------------------------------------------- 906
                       1130      1140      1150      1160      1170      1180      1190      1200
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709294  1104 ---------------------KMKEEEPWRITDNE------------------------LEIYRMKTYRQIRLNELLREN 1138
gi 1079517  1008 ---------------------KLKRESPWKITDAE------------------------LEAVKEKSYRQVRLNELLQEH 1042
gi 1709296  1012 ---------------------KLKRETPWKITDAE------------------------LEAVKEKSYRQVRLNELLQEH 1046
gi 2500792   980 ----------------------------CRISDME------------------------LQTLAVKTNRQLRLRELLLAN 1007
gi 27151684  969 ---------eedeaaagadkiQMTWTRDKYMT--Epwdpshtpdn-----frelvhikpdQSNVRRMHTAVKLNEVIVTR 1032
gi 2599467   969 ---------eedesvagtdkiQMTWTRDKYMEA-Epwdpshtpdn-----frelvhikpdQSNVRRMHTAVKLNEVIVTR 1033
gi 1403707   969 ---------eedesvtgadkiQMTWTRDKYMA--Epwdpshapdn-----frelvhikpdQSNVRRMHTAVKLNEVIVTR 1032
gi 4585229   983 ---------edeetetyqekvHMTWTKDKYMA--Srgqkaksmeg-----fqdllnmrpdQSNVRRMHTAVKLNEVIVNK 1046
gi 1403709   984 ssspspgeepegegetdpekvHLTWTKDKSAAQKNkgpspvssegikdffsmkpewenlNQSNVRRMHTAVRLNEVIVNK 1063
gi 2582381   907 ---------------------FLADGKPVFVEE---------------------------QQVEKFLYTTLKLNLMIQKY 938
                       1210      1220      1230      1240      1250
                 ....*....|....*....|....*....|....*....|....*....|...
gi 1709294  1139 SGTANLIVMSLPVARKGAVSSALYMAWIETLSKDLPPILLVRGNHQSVLTFYS 1191
gi 1079517  1043 SRAANLIVLSLPVARKGSISDLLYMAWLEILTKNLPPVLLVRGNHKNVLTFYS 1095
gi 1709296  1047 SRAANLIVLSLPVARKGSISDLLYMAWLEILTKNLPPVLLVRGNHKNVLTFYS 1099
gi 2500792  1008 SKDARLVVMSLPMPRKGSISAPLYMAWLEMMSRDLPPMLFVRGNHTSVLTFYS 1060
gi 27151684 1033 SHDARLVLLNMPGPPKNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1085
gi 2599467  1034 SHDARLVLLNMPGPPKNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1086
gi 1403707  1033 SHDARLVLLNMPGPPKNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1085
gi 4585229  1047 SHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1099
gi 1403709  1064 SRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEQLDRVMLVRGGGREVITIYS 1116
gi 2582381   939 SRMAAVVLVSLPPPPFN-HPASFYMEYMDLLVENVPRLLIVRGYHKDVVTLFT 990
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap