Conserved Protein Domain Family
PRK14863

?
PRK14863: PRK14863 
bifunctional regulator KidO; Provisional
Statistics
?
PSSM-Id: 184865
View PSSM: PRK14863
Aligned: 6 rows
Threshold Bit Score: 378.876
Threshold Setting Gi: 302381410
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

PRK14863 is a member of the superfamily cl00470.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221236627   1 MSISVSKLGLAAAQFGLDgGSSSAPRGRTPEAEARDILNIAARAKLSVLDASGLFGRAETVLGDLIPRPVPFRVTISTAR 80
gi 167644035   1 MSLAVTKLGLAAAQFGLD-GMSASPRARTPETEARDILTIAARAHLSVLDVSGNYGRAEQVLGDLIPRPVPFRVTLSAAR 79
gi 197103739   1 MTSPLSKLGLGSGQFGFD---QPALRGRPREAEARDILSIAARAGLGVLEIGRHSHTAEAMLGQALPRPCPFRVTLTTVR 77
gi 16127806   33 MSISVSKLGLAAAQFGLDgGSSSAPRGRTPEAEARDILNIAARAKLSVLDASGLFGRAETVLGDLIPRPVPFRVTISTAR 112
gi 302381410   5 RPSPVAKLALAVVT---EpERALPAPVGAREEAMRTLLQTAADSGVSIV-ATRPTGDAERLLGQAWPFPSPFAVTVRTVA 80
gi 295691398   1 MSISVSKLGLAAAQFGLD-GSGSAPRGRSPDAETRDILNIAARARLSVLDASGLFGRAETILGELLPRPTPFRITLAAGR 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221236627  81 ADRGPDFVEAEARAALRRIGVERADAIVVHSPAELFGPHGAALWERLQCLKDQGLFAKIGVSAHASDDPVGVARRFKPDI 160
gi 167644035  80 ADRGPDFVEAEARASLRRLGLERADAIIVPSPSELFGPHGAAVWDRLARLRDAGLFAKIGVAAHASDDPVGVARRFKPDI 159
gi 197103739  78 PDRGPDLVEAELRAQMRRMGVERVDTVLAPSATDLFSPMGPHLWERLRALKDQGLCARIGVSVYASDDPVGLAKRFKPDV 157
gi 16127806  113 ADRGPDFVEAEARAALRRIGVERADAIVVHSPAELFGPHGAALWERLQCLKDQGLFAKIGVSAHASDDPVGVARRFKPDI 192
gi 302381410  81 LSEGLDRVEARARRSLERMGLPRGDTLLVSGATDLAGAEGRALWDRMMALKDRGLYRRIGFLATMEDGPTLLARRYQPDV 160
gi 295691398  80 ADRGPDYVEAEARATLRRLGVERADAIIVHSPSELFGAHGPALWERLQRLKDQGLFAKVGVAAHASDDPVGVAKRFKPDI 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221236627 161 LQAPASLLDQRLLADGSLQRIAGMGIEVHLRSIFLNGLLFLPPDRVPAQLKGASGRLSRVRRMIAEGRSDPLQAALGFAL 240
gi 167644035 160 LQAPASLLDQRLLADGSLARIAGLGIEVQLRSIFLNGLLFLPPDRVPAQLKGASGRLSKVRRMIAEGRSDPLQAALGFAL 239
gi 197103739 158 VQAPASLLDQRLLIDGTLAELASMGVEVHLRSIFLNGVLFLPPDRAPSHLKAAAGRISRARRLIAEGRSDPLQAALGFAL 237
gi 16127806  193 LQAPASLLDQRLLADGSLQRIAGMGIEVHLRSIFLNGLLFLPPDRVPAQLKGASGRLSRVRRMIAEGRSDPLQAALGFAL 272
gi 302381410 161 VQIACNILDQRPVTEGVLSDLAGLGVDVHVASVFARGLLFASRETLPAHLADQGVALSRTRRRLAEARIDPMQAALAFCL 240
gi 295691398 160 LQAPASLLDQRLLADGSLQRIAGMGVEVHLRSIFLNGLLFLPPDRVPAQLKGASGRLSRVRRMIAEGRSDPLQAALGFAL 239
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|..
gi 221236627 241 SRPEGSAVLVGVNSAAELSAVVAAASSPPPDLDWDDMAIDDPVALDPRRWVA 292
gi 167644035 240 SRPEASAVLVGVTSAAELSAVVAAASSPPPDLDWDDMAIDDPVALDPRRWVA 291
gi 197103739 238 SRPEASAVLVGVGSAAEMSAVVAAAMSPPPDLDWDEMALDDPEALA---WAA 286
gi 16127806  273 SRPEGSAVLVGVNSAAELSAVVAAASSPPPDLDWDDMAIDDPVALDPRRWVA 324
gi 302381410 241 GLPPVAAVVASVASAAELRAVLAAAHAPRPDLDWEALALSEPAAFTTGSLSR 292
gi 295691398 240 SRPEGSAVLVGVNSAAELSAVVAAASSPPPDLDWDEMAIDDPVALDPRRWVA 291
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap