Conserved Protein Domain Family
PRK13483

?
PRK13483: PRK13483 
enterobactin receptor protein; Provisional
Statistics
?
PSSM-Id: 184080
View PSSM: PRK13483
Aligned: 20 rows
Threshold Bit Score: 1130.26
Threshold Setting Gi: 264680523
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

PRK13483 is classified as a model that may span more than one domain.
PRK13483 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56461590    4 SISGLKLSILALTVASAVGVAQAQEQEKPKrkhhkhKDMEVMVVTASGVAQHLKEAPASISVIDRRDLSQRFYKDLTDAM 83
gi 15640502    1 MSRFNPSPVSLSVTLGLMFSASAFAQDAT-------KTDETMVVTAAGYAQVIQNAPASISVISREDLESRYYRDVTDAL 73
gi 92114796    1 --MNHPSRIATLTLVTAAVSTPVAHAAESD------VALNDVVVTAAGYAQQVTSAPASISVISREQLENKAYRDITDAL 72
gi 28899376    1 MSTLRLPVLTATGVLAFVSVPHVFANDSV-------SKMETVVVTASSYEQSQADAPASISVISREELDSRYYRDVTDAL 73
gi 147674899   1 MSRFNPSPVSLSVTLGLMFSASAFAQDAT-------KTDETMVVTAAGYAQVIQNAPASISVISREDLESRYYRDVTDAL 73
gi 116696031   1 -----MRMLAAACAASGMTGAWAQAQALKTe-----ATLATVVVTAAGSEQDIRDAPASISVVTRKDLENKAYRDINDAL 70
gi 77362165    1 MNTASRQLLPLSAAILFTFTNYAQANKTN-------DDMEVMVVTASGYEQLIKNAPASISVIDREELASRFYRDLTDAM 73
gi 194292543   1 -----MKGLAAVCAASGMAGAWAQAQESKAe-----ATLATVVVTASGSAQDIRDAPASISVVTRSDLENKAYRDINDAL 70
gi 229606231   1 MSRFNPSPVSLSVTLGLMFSASAFAQDAT-------KTDETMVVTAAGYAQVIQNAPASISVISREDLESRYYRDVTDAL 73
gi 227080685   1 MSRFNPSPVSLSVTLGLMFSASAFAQDAT-------KTDETMVVTAAGYAQVIQNAPASISVISREDLESRYYRDVTDAL 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56461590   84 TDAPGVIVTGGG---DRQDISLRGMGADYTLILVDGQRQSSRETRPNSDGPGVEGAWTPPLAAIDRIEVIRGPMSSLYGS 160
gi 15640502   74 KSVPGVTVTGGG---DTTDISIRGMGSNYTLILVDGKRQTSRQTRPNSDGPGIEQGWLPPLQAIERIEVIRGPMSTLYGS 150
gi 92114796   73 RDVPGVIVTGGGrgdNGADISMRGMPAQYTLILVDGRRQSSRESRPNG-SAGFEQDWLPPLQAIERIEVIRGPMSTLYGS 151
gi 28899376   74 KSVPGVVVTGGG---DTTDISIRGMGSKYTLILVDGKRQSTRETRPNSDGPGIEQGWLPPLQAIERIEVIRGPMSTLYGS 150
gi 147674899  74 KSVPGVTVTGGG---DTTDISIRGMGSNYTLILVDGKRQTSRQTRPNSDGPGIEQGWLPPLQAIERIEVIRGPMSTLYGS 150
gi 116696031  71 VEVPGVIVSGGG---DRTDISLRGMGAKYTQILIDGKRQNSRETRTNSDSSGVESSWTPPLSAIERIEVVRGPMSSLYGS 147
gi 77362165   74 TDVPGVIVTGGG---DRKDISLRGMANGYTLILIDGQRQTSRETRPNSDGPGVEGAWTPPIGAIERIEVIRGPMSSLYGS 150
gi 194292543  71 VDVPGVIVSGGG---DRTDISLRGMGAKYTQVLIDGKRQSSRETRTNSDSSGVESSWTPPLAAIERIEVVRGPMSSLYGS 147
gi 229606231  74 KSVPGVTVTGGG---DTTDISIRGMGSNYTLILVDGKRQTSRQTRPNSDGPGIEQGWLPPLQAIERIEVIRGPMSTLYGS 150
gi 227080685  74 KSVPGVTVTGGG---DTTDISIRGMGSNYTLILVDGKRQTSRQTRPNSDGPGIEQGWLPPLQAIERIEVIRGPMSTLYGS 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56461590  161 DAIGGVINIITRKTPEEWRSEIRVDGTLQERSESGNSYQTNLFTSGSLIKDTLGIQLSAGYTRRLEDEIVSGYRDKTAED 240
gi 15640502  151 DAIGGVINIITRKDQQQWSGNVQLSTVVQENRASGDEQSANFFVTGPL-SDALSLQVYGQTTQRDEDEIEHGYGDKSLRS 229
gi 92114796  152 DAIGGVINVITRKVADEWHGNVRAEATLQEDSDSGNANQGQLYVSGPLADDLLGLQVYGQYQKREEDDIEEGYEDKDLQS 231
gi 28899376  151 DAIGGVINVITRKDALEWTGNVQLGTVIQENSRSGGEQSANFFVNGPL-AENLLLQVYGQYTAREEDDIDYGYEDKDMQS 229
gi 147674899 151 DAIGGVINIITRKDQQQWSGNVQLSTVVQENRASGDEQSANFFVTGPL-SDALSLQVYGQTTQRDEDEIEHGYGDKSLRS 229
gi 116696031 148 DAMGGVINIITRKVPRTWTGELRGDATLQENSDSGNLYQGNFYLAGPLKSELLGLQLYGQSTHRIEDDIDYGFRGRRAES 227
gi 77362165  151 DAIGGVINIITRKTPEHWYGEVRLDSTIQQSNESGNINQANFFTAGSLVDELLGVQLYGQFTKRDEDDLVAGFRGKEQNN 230
gi 194292543 148 DAMGGVVNIITRKVPKQWTGELRGDATLQQHSDSGNQYQGNFYLAGPLKSDLLGLQLYGQSTHRIEDDIDYGFRGRRAES 227
gi 229606231 151 DAIGGVINIITRKDQQQWSGNVQLSTVVQENRASGDEQSANFFVTGPL-SDALSLQVYGQTTQRDEDEIEHGYGDKSLRS 229
gi 227080685 151 DAIGGVINIITRKDQQQWSGNVQLSTVVQENRASGDEQSANFFVTGPL-SDALSLQVYGQTTQRDEDEIEHGYGDKSLRS 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56461590  241 ADLKLAYTPNRDHEILFEVGTAQQSIDASVGKTIEPLAPGEECGRRGCPESSTTEYDNTSVSIAHNGQW-GMVGARSYLK 319
gi 15640502  230 LTSKLNYQLNPDHQLQLEAGVSAQDRENNVGKSA------QSSGCRGTCSNTDNQYRRNHVAVSHQGDWqDVGQSDTYLQ 303
gi 92114796  232 LTAKFSLTPSEHHDVGLEVGKETQDRAAHVGKSA------PAEGCRGGCTDSHSTHDREHYALTHTGRW-GFATSNSYVQ 304
gi 28899376  230 ISSKLIYQINDRHSVQLEGGTSAQSRRGNVGLSV------PTTGCRRGCEDSLNEYRRNYVTLSHTGEWeLLGNSDTYLQ 303
gi 147674899 230 LTSKLNYQLNPDHQLQLEAGVSAQDRENNVGKSA------QSSGCRGTCSNTDNQYRRNHVAVSHQGDWqGVGQSDTYLQ 303
gi 116696031 228 LTAKLALTPTRNHDIVFEATGMRQLRSETVGKTVPPLPPGTACPRSGCPTSSETDYRSEKYALSHTGRW-GFGVSDSYIQ 306
gi 77362165  231 LKAKFIVTPNKNHEVTLELGRAEQTLDATVGKTIAPLAPGDECGRSGCPESTTTQYEQKTISVSHNGYY-DFGSSNSYIK 309
gi 194292543 228 LTAKLALTPTRQHDIVFEATGMRQQRSETVGKTVPPLPPGTPCPRTGCPTSSETDYRSEKYALSHTGRW-GFGVSDSYIQ 306
gi 229606231 230 LTSKLNYQLNPDHQLQLEAGVSAQDRENNVGKSA------QSSGCRGTCSNTDNQYRRNHVAVSHQGDWqDVGQSDTYLQ 303
gi 227080685 230 LTSKLNYQLNPDHQLQLEAGVSAQDRENNVGKSA------QSSGCRGTCSNTDNQYRRNHVAVSHQGDWqDVGQSDTYLQ 303
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56461590  320 RDEYENKARIMTIKNTDFQSHWNVPLLEESSMNLGVAYQKEELEDLTSNQIS-DRNRIEGSQWSAFAETAWPIFNDFNLT 398
gi 15640502  304 YEENTNKSREMSIDNTVFKSTLVAPIG-EHMLSFGVEGKHESLEDKTSNKIS-SRTHISNTQWAGFIEDEWALAEQFRLT 381
gi 92114796  305 RESTQNKARDMEITNTVANTQWVMPLS-RHIVTLGANYEKEELDDRTSNQIS-DLTQVSNDQWALFVEDEWLLTQDVSLT 382
gi 28899376  304 REESENKSREMTIVNTTFKSSLVKGLG-AHTLTTGVDATHAELEDFTSNKAS-SKTKASNTQWAVFIEDEWKIAEPFSLT 381
gi 147674899 304 YEENTNKSREMSIDNTVFKSTLVAPIG-EHMLSFGVEGKHESLEDKTSNKIS-SRTHISNTQWAGFIEDEWALAEQFRLT 381
gi 116696031 307 QEEFDNRSRRMKIKNLDLRTSWAMPLG-NHMLSVGGEYLNQRLNDQTGNQIAgGPNQVERYQWALFAEDEWRLAQSFALT 385
gi 77362165  310 YDEYNNKSREMLIKNTDAQTMWSIPLASEHNATLGASYKKEDLTDHTSNKLS-DVSQIDNEQWSIFSEDEWRTSELFALT 388
gi 194292543 307 QEEFDNRSRRMKIKNLNARTSWAMPLG-NHMLSVGAEYLNQRLNDQTGNQIAgGPNRVERYQWAMFAEDEWRLAQSFALT 385
gi 229606231 304 YEENTNKSREMSIDNTVFKSTLVAPIG-EHMLSFGVEGKHESLEDKTSNKIS-SRTHISNTQWAGFIEDEWALAEQFRLT 381
gi 227080685 304 YEENTNKSREMSIDNTVFKSTLVAPIG-EHMLSFGVEGKHESLEDKTSNKIS-SRTHISNTQWAGFIEDEWALAEQFRLT 381
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56461590  399 TGVRYDDDDIFGGHWSPRVYGVYTLSDATTIKGGVSTGFRAPSLRETTADWGQVSRGGNVYGNPDLEAETSTNYELGLYT 478
gi 15640502  382 FGGRLDHDKNYGSHFSPRVYGVWNLDPLWTVKGGVSTGFRAPQLREVTPDWGQVSGGGNIYGNPDLKPETSINKELSLMY 461
gi 92114796  383 GGVRLDDNENYGSHVSPRLYGVWQAAPRWTLKGGVSTGYRAPGLREITPGWGQISRGGNVYGNPDLEPETSLNKELALLY 462
gi 28899376  382 LGGRLDHDENYGAHFSPRVYGVWRVAPAWTVKGGVATGFRSPQLREITPGWAQVSGGGNIYGNPDLDPETSLNKEISVLY 461
gi 147674899 382 FGGRLDHDKNYGSHFSPRVYGVWNLDPLWTVKGGVSTGFRAPQLREVTPDWGQVSGGGNIYGNPDLQPETSINKELSLMY 461
gi 116696031 386 GGVRMDHDQNFGQHYSPRLYGVWHAAERWTVKGGVSTGFRAPDLRQTVAGWGQTSRGGNMYGNPDLKPETMLSQELGLLY 465
gi 77362165  389 GGIRYDHDGNFGGHISPRLYGVLNASDNLTVKGGISTGFKAPSLRATTPEWGQVSRGGNIYGNANLAPEKSINYEVGVYY 468
gi 194292543 386 GGVRMDHDQNFGQHYSPRLYGVWHAAERWTVKGGVSTGFRAPDLRQTVAGWGQTSRGGNMYGNPDLKPETMVSQELGLLY 465
gi 229606231 382 FGGRLDHDKNYGSHFSPRVYGVWNLDPLWTVKGGVSTGFRAPQLREVTPDWGQVSGGGNIYGNPDLKPETSINKELSLMY 461
gi 227080685 382 FGGRLDHDKNYGSHFSPRVYGVWNLDPLWTVKGGVSTGFRAPQLREVTPDWGQVSGGGNIYGNPDLKPETSINKELSLMY 461
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56461590  479 DWGRRSSTSITVFYNEFDDKITRVDCPESICDAGPNQFGSMPTTRINIDEAVTRGIEMTLSTHFSREWSLKGNYTYTDSE 558
gi 15640502  462 STGSGLAASLTAFHNDFKDKITRVACPANICTAGPNQWGAAPTYRVNIDEAETYGAEATLSLPITESVELSSSYTYTHSE 541
gi 92114796  463 SAPSGLNASMTLFHNDFEDKITRVACPDSVCAAGPNQFGADPTYRINVDEAVTRGVELSLSSPLTETLSLSTSYTYTDSE 542
gi 28899376  462 QGDSGLDVTLTAFHNEFKDKITRVVCPDTICTDGPNQWGADPTYRINVDEAVTQGVEATLAKPLTETIYLSSSYTFTDSE 541
gi 147674899 462 STGSGLAASLTAFHNDFKDKITRVACPANICTAGPNQWGATPTYRVNIDEAETYGAEATLSLPITESVELSSSYTYTHSE 541
gi 116696031 466 DKGNGLQAGVTLFNNDFKDKITRVACPATQCTDAPNRFGANPTTYMNVDRAYSRGVEASLRWPIAQAWSLTGSYTYTKSE 545
gi 77362165  469 DKGEKFSTSATVFYNQFDDKISRIACPLTQCTDGPNEFGSDPTTYVNVDEAVTQGFELSASLKLSSKVSASANYTYTESE 548
gi 194292543 466 DKGNGLQAGVTLFNNDFKDKITRVACPLMQCTDGPNQFGAAPTTYMNVDRAYSRGVEASLRWPIAQAWSLTGSYTYTRSE 545
gi 229606231 462 STGSGLAASLTAFHNDFKDKITRVACPANICTAGPNQWGAAPTYRVNIDEAETYGAEATLSLPITESVELSSSYTYTHSE 541
gi 227080685 462 STGSGLAASLTAFHNDFKDKITRVACPANICTAGPNQWGAAPTYRVNIDEAETYGAEATLSLPITESVELSSSYTYTHSE 541
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56461590  559 QKSGEYKGEPLNQLPKHLVQTSLNWKPGKRWNSWLRVHYRGEESQPTTGPSQGSLVAPSYTLADFGVNYFVTRDLKLAAG 638
gi 15640502  542 QKSGNFAGRPLLQLPKHLFNANLSWQTTDRLNSWANLNYRGKEMQPEGGASNDDFIAPSYTFIDTGVTYALTDTATIKAA 621
gi 92114796  543 QKSGEYEGNPLTKLPEHQFSGTLDWTPVARLNAWARLTYRGKESQPVEGPSSSSIRAPSYTFVDSGGAWRLTERAKLMVG 622
gi 28899376  542 QKTGEYKGMPLQQLPKHLFNVDVTWQTTDNLESWTKVTYRGKEMDPVTGPSRNSIVEPAYTFVDAGVTYQLTDNTKIKGA 621
gi 147674899 542 QKSGNFAGRPLLQLPKHLFNANLSWQTTDRLNSWANLNYRGKEMQPEGGASNDDFIAPSYTFIDTGVTYALTDTATIKAA 621
gi 116696031 546 QKSGQYQGQPLNQLPMHLLVATLNWRPSEKINAWARVNYRGKESQPITGPSSSTVVAPSYTFVDLGATYTVTRNVSVFAG 625
gi 77362165  549 QKTGAYAGSPLNQLPTHLLQTSVNWVLSDAFSAWARMHYRGEESQPTTGPSQSSLIAPSYTTADLGANYQLSNNIKLGVG 628
gi 194292543 546 QKSGQYQGQPLNQLPMHLLVATLNWSPSEKLNAWARVNYRGKESQPITGPSSSTVVAPSYTFVDLGATYALTKNVSVFAG 625
gi 229606231 542 QKSGNFAGRPLLQLPKHLFNANLSWQTTDRLNSWANLNYRGKEMQPEGGASNDDFIAPSYTFIDTGVTYALTDTATIKAA 621
gi 227080685 542 QKSGNFAGRPLLQLPKHLFNANLSWQTTDRLNSWANLNYRGKEMQPEGGASNDDFIAPSYTFIDTGVTYALTDTATIKAA 621
                        650       660       670
                 ....*....|....*....|....*....|.
gi 56461590  639 VYNLFDKEIGVEEYGYVEDGRRLWLSAAYSF 669
gi 15640502  622 VYNLFDQEVNYAEYGYVEDGRRYWLGLDIAF 652
gi 92114796  623 VYNMFDEEIDYDEYGYVEDGRRYWVGASLDF 653
gi 28899376  622 IYNLFDEDINYKEYGYVEDGRRYWLGLDVAF 652
gi 147674899 622 VYNLFDQEVNYAEYGYVEDGRRYWLGLDIAF 652
gi 116696031 626 IYNLFDKQVNYTDYGHVEDGRRYWMSVSVKF 656
gi 77362165  629 VYNLFDKEISEVEYGYVEDGRRYWASLAWQF 659
gi 194292543 626 IYNLFDKQVNYTDYGYVEDGRRYWMSVAVKF 656
gi 229606231 622 VYNLFDQEVNYAEYGYVEDGRRYWLGLDIAF 652
gi 227080685 622 VYNLFDQEVNYAEYGYVEDGRRYWLGLDIAF 652
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap