Conserved Protein Domain Family
PRK12682

?
PRK12682: PRK12682 
transcriptional regulator CysB-like protein; Reviewed
Statistics
?
PSSM-Id: 183679
View PSSM: PRK12682
Aligned: 38 rows
Threshold Bit Score: 472.169
Threshold Setting Gi: 119898618
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

PRK12682 is classified as a model that may span more than one domain.
PRK12682 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33602706    1 MNLQQFRFVRETIRRDFNLTEAARMLYTSQPGVSKAIIEFEDELGIKIFERHGKRIKGLTKPGLAVSQVIDRIMREVDNL 80
gi 59801907    1 MKLQQLKYALEVYRHNLNVSEAAEALFTSQPGISKQIKLLEEEIGIQIFIRSGKRVVSVSQPGKVVLDIAERILRDVQNI 80
gi 194099402   1 MKLQQLKYALEVYRHNLNVSEAAEALFTSQPGISKQIKLLEEEIGIQIFIRSGKRVVSVSQPGKVVLDIAERILRDVQNI 80
gi 254805584   1 MKLQQLKYALEVYQHNLNVSEAAEALFTSQPGISKQIKLLEEEIGIQIFIRSGKRVVSVSQPGKVVLDIAERILRDVQNI 80
gi 15676295    1 MKLQQLKYALEVYQHNLNVSEAAEALFTSQPGISKQIKLLEEEIGIQIFIRSGKRVVSVSQPGKVVLDIAERILRDVQNI 80
gi 218768846   1 MKLQQLKYALEVYRHNLNVSEAAEALFTSQPGISKQIKLLEEEIGIQIFIRSGKRVVSVSQPGKVVLDIAERILRDVQNI 80
gi 121635481   1 MKLQQLKYALEVYRHNLNVSEAAEALFTSQPGISKQIKLLEEEIGIQIFIRSGKRVVSVSQPGKVVLDIAERILRDVQNI 80
gi 161870688   1 -------------------------MFTSQPGISKQIKLLEEEIGIQIFIRSGKRVVSVSQPGKVVLDIAERILRDVQNI 55
gi 119898618   1 MNVSQLRLVLEAIRQNFNLSGVASSLFISQPGVSRQIKELEDELGVELFERRGKRLTGLTPPGEMLVPVIDRILLDVRNL 80
gi 251790290   1 MNFQQLKIIRESARCNYNLTEVANTLFTSQSGVSRHIRELEEELGIEIFIRRGKRLLGMTEPGKELLVMAERILNDANHI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33602706   81 KKVSDEFARRDEGGLVIACTHTQARYLLPRVIPAFRKQFPKVHLSLAEGSPSQLAEMVLHEQADLALATESLALTPGLAT 160
gi 59801907   81 KNIGSEFTGQDSGSLTVATTHTQARYALPLIVADFVKRYPKVNLTIKQGSPAAIAQMVTSGESDLAIVTERIDDHPELGR 160
gi 194099402  81 KNIGSEFTGQDSGSLTVATTHTQARYALPLIVADFVKRYPKVNLTIKQGSPAAIAQMVTSGESDLAIVTERIDDHPELGR 160
gi 254805584  81 KNIGSEFTGQDSGSLTVATTHTQARYALPLIVADFVKRYPKVNLTIKQGSPAAIARMVTSGEADLAIVTERIDDHPELGK 160
gi 15676295   81 KNIGSEFTGQDSGSLTVATTHTQARYALPLIVADFVKRYPKVNLTIKQGSPAAIARMVTSGEADLAIVTERIDDHPELGK 160
gi 218768846  81 KNIGSEFTGQDSGSLTVATTHTQARYALPLIVADFVKRYPKVNLTIKQGSPAAIAQMVTSGESDLAIVTERIDDHPELGR 160
gi 121635481  81 KNIGSEFTGQDSGSLTVATTHTQARYALPLIVADFVKRYPKVNLTIKQGSPAAIARMVTSGEADLAIVTERIDDHPELGK 160
gi 161870688  56 KNIGSEFTGQDSGSLTVATTHTQARYALPLIVADFVKRYPKVNLTIKQGSPAAIAQMVTSGESDLAIVTERIDDHPELGR 135
gi 119898618  81 KQVADRFAIQDCGQLRIASTHTQARYLLPAALHDFRARFPKVKLVLQQGTPAQIAEWVANGEADLGVSTEAIDRHRDLQA 160
gi 251790290  81 RRLANLFSDNDVGQLVIATTHTQARYSLPEIIKAFRSLYPQVQLVLNQGTPDEIVAMLESGEADIGIATEQLMNVNSLAA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33602706  161 LPVYTWEHTVVVRPDHPLTeltssQARRLTLAQLAEYPIVTYDRAFTGRTTIDEIFANQGI-HPDIVLEAIDADVIKTYV 239
gi 59801907  161 LSCYDWTHAVIVPNDHPLLe----CRNPLRIEDLARFPLITYEFAFNAGSSIARAFAKARLeRPDVALAAADTDVLKTYV 236
gi 194099402 161 LSCYDWTHAVIVPNDHPLLe----CRNPLRIEDLARFPLITYEFAFNAGSSIARAFAKARLeRPDVALAAADTDVLKTYV 236
gi 254805584 161 LPCYDWTHAVIVPNDHPLLe----CRNPLRIEDLARFPLITYEFAFNTGSSIARAFSKARLeQPDVALAAADTDVLKTYV 236
gi 15676295  161 LPCYDWTHAVIVPNDHPLLe----CRNPLRIEDLARFPLITYEFAFNAGSSIARAFSKARLeQPDVALAAADTDVLKTYV 236
gi 218768846 161 LSCYDWTHAVIVPNDHPLLe----CRNPLRIEDLARFPLITYEFAFNAGSSIARAFSKARLeQPDVALAAADTDVLKTYV 236
gi 121635481 161 LPCYDWTHAVIVPNDHPLLe----CRNPLRIEDLARFPLITYEFAFNAGSSIARAFSKARLeQPDVALAAADTDVLKTYV 236
gi 161870688 136 LSCYDWTHAVIVPNDHPLLe----CRNPLRIEDLARFPLITYEFAFNAGSSIARAFSKARLeQPDVALAAADTDVLKTYV 211
gi 119898618 161 FPVREWHHAVIVPPAHPLA-----AAGELTLAALAEHPLVTYGEGFAGRSVIDAAFSAAGL-APDVVLAALDADVIVTYV 234
gi 251790290 161 FPWYRWHHAVLVPEGHTLA-----LASPITLDTLSEVPLITYRQGITGRSRIDRAFAAAGL-TPHISISAQDSDVIKTYV 234
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 33602706  240 DVGLGIGIIAGVAYDP-RRDANLVGLPVGHLFGTHTTRVGVKSGVFLRDYVYTFMEMMAPGLTRQVVSEAVQGGPA 314
gi 59801907  237 RLGLGVGLMAKMAYNP-DTDGDLQLVDAAHLFEPSPTWIALRSDTYLRGYAYDFIQAFAPHLTREKVDRILYTPIS 311
gi 194099402 237 RLGLGVGLMAKMAYNP-DTDGDLQLVDAAHLFEPSPTWIALRSDTYLRGYAYDFIQAFAPHLTREKVDRILYTPIS 311
gi 254805584 237 RLGLGVGLMAKMAYNP-DTDGDLQLVDAAHLFEPSPTWIALRSDTYLRGYAYDFIQAFAPHLTREKVDRILYTPIS 311
gi 15676295  237 RLGLGVGLMAKMAYNP-DTDGDLQLVDAAHLFEPSPTWIALRSDTYLRGYAYDFIQAFAPHLTREKVDRILYTPIS 311
gi 218768846 237 RLGLGVGLMAKMAYNP-DTDGDLQLVDAAHLFEPSPTWIALRSDTYLRGYAYDFIQAFAPHLTREKVDRILYTPIS 311
gi 121635481 237 RLGLGVGLMAKMAYNP-DTDGDLQLVDAAHLFEPSPTWIALRSDTYLRGYAYDFIQAFAPHLTREKVDRILYTPIS 311
gi 161870688 212 RLGLGVGLMAKMAYNP-DTDGDLQLVDAAHLFEPSPTWIALRSDTYLRGYAYDFIQAFAPHLTREKVDRILYTPIS 286
gi 119898618 235 EAGFGVGIVAEMAARGaAARGGVAQLDARHLFGPNVARVAVRRGAYLREYALELVAMLAAERSLDDILSALQRDLA 310
gi 251790290 235 ELGLGVGIVADMSFDA-VRDPGLVRLDAGHLFDDNTVWLGLKRGQLQRNYIWKFIQLCNPELSQDDIKSRVFADEN 309
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap