Conserved Protein Domain Family
rplM

?
PRK09216: rplM 
50S ribosomal protein L13; Reviewed
Statistics
?
PSSM-Id: 181703
View PSSM: PRK09216
Aligned: 973 rows
Threshold Bit Score: 151.375
Threshold Setting Gi: 256370658
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

PRK09216 is a member of the superfamily cl00333.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15892238    1 MKTYSAKPSEIE-KKWWVIDAKNIVLGRLASRVANMLRGKHKPSFTPHLDCGDNIIIINAEHVKLTGKKanpKDGKIYYR 79
gi 15835020    7 TKTTLAKASDDQnKAWYVINAEGKTLGRLSSEVAKILRGKHKVTFTPHVAMGDGVIVINAEKVRLTGAK---RAQKVYHY 83
gi 15618171    7 TKTTIVKSSETT-KSWYVVDAAGKTLGRLSSEVAKILRGKHKVTYTPHVAMGDGVIVINAEKVRLTGAK---KGQKIYRY 82
gi 15835782    7 TKTTIVKSSETT-KSWYVVDAAGKTLGRLSSEVAKILRGKHKVTYTPHVAMGDGVIVINAEKVRLTGAK---KGQKIYRY 82
gi 16752791    7 TKTTIVKSSETT-KSWYVVDAAGKTLGRLSSEVAKILRGKHKVTYTPHVAMGDGVIVINAEKVRLTGAK---KGQKIYRY 82
gi 29840291    7 TKTTIAKASDAQnKSWYVIDATGKTLGRLSSEVAKILRGKHKVTYTPHIAMGDGVIVINAEKVHLTGAK---KGQKIYRY 83
gi 33241589    7 TKTTIVKSSETT-KSWYVVDAAGKTLGRLSSEVAKILRGKHKVTYTPHVAMGDGVIVINAEKVRLTGAK---KGQKIYRY 82
gi 297621451  10 QKSFFQKKEEVE-RNWFVLDAEGKTLGRFASEVAKVLRGKHKPTFTPSTDGGDGVIVINAEKIAVTGAK---EAQKSYIY 85
gi 62185144    7 TKTTIAKASEAQnKSWYVIDAAGKTLGRLSSEVAKILRGKHKVTYTPHVAMGDGVIVINAEKVHLTGAK---KGQKIYRY 83
gi 89898284    7 TKTTIAKASESQnKSWYVIDATGKTLGRLSSEVVKILRGKHKVTYTPHVAMGDGVVIINAEKVHLTGAK---KNQKIYRY 83
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 15892238   80 YTGFPGGIKDTTAGkILSGKHPERVIKMAVKRMITRNALGAKQMSNLYVYANGDH-PHMAQQPTVYDF 146
gi 15835020   84 YTGFISGMREVPFE-NMIARKPAYVIEHAVKGMLPKTKLGRRQMKSLRVVKGSSYaQYEAIKPIVLDA 150
gi 15618171   83 YTGYISGMREIPFE-NMMARKPNYIIEHAIKGMMPRTRLGKKQLKSLRIVKGDSYeTFESQKPILLDI 149
gi 15835782   83 YTGYISGMREIPFE-NMMARKPNYIIEHAIKGMMPRTRLGKKQLKSLRIVKGDSYeTFESQKPILLDI 149
gi 16752791   83 YTGYISGMREIPFE-NMMARKPNYIIEHAIKGMMPRTRLGKKQLKSLRIVKGDSYeTFESQKPILLDI 149
gi 29840291   84 YTGYISGMREIPFE-NMLAKKPSYIIEHAIKGMMPKTRLGKRQLKSLRILKGDCYkTFEAQKPILLDV 150
gi 33241589   83 YTGYISGMREIPFE-NMMARKPNYIIEHAIKGMMPRTRLGKKQLKSLRIVKGDSYeTFESQKPILLDI 149
gi 297621451  86 HTGHVGGQREIPYR-VMQARKPEYIIEHAVKGMMPKTVLGRKQMRRLRIYAGAEH-QLHAQKPVTANI 151
gi 62185144   84 YTGYISGMREVAFE-NMIAKKPSYIIEHAIKGMMPKTRLGKRQVKSLRILKGDYYqEFKSQKPIVLDV 150
gi 89898284   84 YTGYISGMREVPFE-NMLAKKPSYIIEHAIKGMMPKTRLGKRQFKSLRILKGDCYkTFESQKPIVLDV 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap