NCBI CDD Logo
?
PLN02774: PLN02774 
brassinosteroid-6-oxidase
Statistics
?
PSSM-Id: 178373
View PSSM: PLN02774
Aligned: 11 rows
Threshold Bit Score: 898.754
Threshold Setting Gi: 115454045
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PLN02774 is a member of the superfamily cl12078.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115454045   1 MVLVAIGVVVAAAVVVSSLlLRWNEVRYSRKrGLPPGTMGWPLFGETTEFLKQGPSFMKARRLRYGSVFRTHILGCPTVV 80
gi 18406372    3 IMMMILGLLVIIVCLCTAL-LRWNQMRYSKK-GLPPGTMGWPIFGETTEFLKQGPDFMKNQRLRYGSFFKSHILGCPTIV 80
gi 30693327    3 AMMVMMGLLLIIVSLCSAL-LRWNQMRYTKN-GLPPGTMGWPIFGETTEFLKQGPNFMRNQRLRYGSFFKSHLLGCPTLI 80
gi 242038893   3 VLLLLVAVL--GVVLASSLlLRWNELRYSRRrGLPPGTMGWPLFGETTEFLKQGPSFMKQRRLRYGSLFRTHILGCPTVV 80
gi 225451804   3 VFMAVFGVVLIGLCICTAL-LRWNEVRYRKK-GLPPGTMGWPVFGETTEFLKQGPSFMKNQRARYGKFFKSHLLGCPTTV 80
gi 225423426   2 AVLVVIFVLVVALSVCFAL-LKWNEIRYSRR-GLPPGTMGWPLFGETTDFIKQGPDFMKKQRARYGSFFKTHILGCPTII 79
gi 224077752   3 VFFVVLVVVLFLFGISSAL-LRWNEVRYRKK-GLPPGTMGWPIFGETTEFLKQGPNFMKNQSARYGSFFKSHILGCPTIV 80
gi 224112092   3 LLLVLASWLFVGLFVCFVFaLKWNEIRYGRK-GLPPGTMGWPLFGETAEFLKHGPDFMKKQRARYGNLFRSHVLGFPTVI 81
gi 224120652   3 VLLMVLVAVLFLFCISSAL-LRLNEVRYRKK-GLPPGTMGWPVFGETTEFLKQGPNFMKNQRARYGSIFKSHILGCPTIV 80
gi 297815290   3 IMIMILGLLVIIVCICSAL-LRWNQMRYSKK-GLPPGTMGWPIFGETTEFLKQGPDFMKNQRLRYGSFFKSHILGCPTIV 80
gi 297801724   3 TMMVMMGLLFIIVSLCSAL-LRWNQMRYTKN-GLPPGTMGWPIFGETTEFFKHGPNFMRNQRLRYGNFFKSHLLGCPTLV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115454045  81 CMEAELNRRALASEGRGFVPGYPQSMLDILGRNNIAAVQGPLHRAMRGAMLSLVRPAMIRSSLLPKIDAFMRSHLAAWSS 160
gi 18406372   81 SMDAELNRYILMNESKGLVAGYPQSMLDILGTCNIAAVHGPSHRLMRGSLLSLISPTMMKDHLLPKIDDFMRNYLCGWDD 160
gi 30693327   81 SMDSEVNRYILKNESKGLVPGYPQSMLDILGTCNMAAVHGSSHRLMRGSLLSLISSTMMRDHILPKVDHFMRSYLDQWNE 160
gi 242038893  81 CMEPELNRRTLASDGAGFVPGYPQSMLDILGPNNIAAVHGPLHRAMRGAMLALTRAHMIRAALLPKIDAFMRAHLHGWAG 160
gi 225451804  81 SMDPELNRYILMNEAKGLVPGYPQSMLDILGKCNIAAVHGSTHKYMRGALLALISPTMIRGQLLPKIDEFMRSHLNKWDT 160
gi 225423426  80 SMDPELNRYVLLNEGKGLVPGYPQSMLDILGEHNIAAVQGSTHKYIRGSMLSLIAPPMIKDQLLRKIDQGMRFHLSNWDG 159
gi 224077752  81 SMDPELNRYILMNEAKGLVPGYPQSMLDILGNCNIAAVHGSTHKYMRGALLSLISPTMIREQLLPTIDEFMRTHLSDWDS 160
gi 224112092  82 CTDPELNRYILLNETRGLVPGYPQSSQDILGKHNVGVVTGSAHKYLRGSLLSLVNPTMIKDHLLLNIDESVRSFLANWEG 161
gi 224120652  81 SMDPELNRYILMNEGKGLVPGYPQSMLDILGNRNIAAVHGSTHKYMRGALLSLISPTMIREQLLPTIDEFMRTHLSYWDT 160
gi 297815290  81 SMDAELNRYILMNESKGLVAGYPQSMLDILGTCNIAAVHGPSHRLMRGSLVSLISPAMMKDHLLPKIDDFMRNYLCGWDD 160
gi 297801724  81 SMDSEVNRYILKNESKGLVPGYPQSMLDILGTCNMAAVHGSSHRLMRGSLLSLISSTMMRDHILPKVDHFMRSYLGQWNE 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115454045 161 SSssaVVDIQAKTKEMALLSALRQIAGVSAGPLSDALKAELYTLVLGTISLPINLPGTNYYQGFKARKKLVAMLEQMIAE 240
gi 18406372  161 LE---TVDIQEKTKHMAFLSSLLQIAETLKKPEVEEYRTEFFKLVVGTLSVPIDIPGTNYRSGVQARNNIDRLLTELMQE 237
gi 30693327  161 LE---VIDIQDKTKHMAFLSSLTQIAGNLRKPFVEEFKTAFFKLVVGTLSVPIDLPGTNYRCGIQARNNIDRLLRELMQE 237
gi 242038893 161 RR----VDIQEMTKEMALLSALRQIAGISAGPLSDALKAELYTLVLGTFSLPINIPGTNYSKGLQARKKLVAMLRQMIAD 236
gi 225451804 161 -K---IINIQEKTKEMALLSSLKQIAGIESGTISKEFMPEFFKLVLGTISLPIDLPGTNYRRGFQARKNIVGMLRQLIEE 236
gi 225423426 160 -R---TIDIQEKTNEMALFIPFKLIMETESASIYETFKREFDKLVEGTLSLPINIPGTSYHHGFQGRKNVIRMLKGVMEK 235
gi 224077752 161 -K---IIDIQQMTKEMALLSALKQIVGIDSSSISQAFMPEFFKLVLGTLSLPIDLPGTNYTRGVQARKKIISMFRKVIQE 236
gi 224112092 162 -K---TIDLQDRTVEFAFVIAFKLIVDSQSSVIYDNFKSEFDKLAAGTISLAINIPGTAYHSGMQGRTRVVKMLRQVIKE 237
gi 224120652 161 -K---IIDIQQMTKEMALLSALKQIAGTDSCSISQAFMPEFFRLVLGTLSLPIDLPGTNYRQGVQARKNIVRMLRQLIDG 236
gi 297815290 161 LE---TVDIQEKTKHMAFLSSLLQIAETLKKPEVEEYRTEFFKLVVGTLSVPIDLPGTNYRSGVQARNNIDRLLTELMQE 237
gi 297801724 161 LE---VIDIQDKTKHMAFLSSLTQIAGNLRKPFIEEFKTAFFKLVVGTLSVPIDLPGTNYRCGIQARKNIDRFLRELMQE 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115454045 241 RRSSGQVHDDMLDALLTgVEGTREKLTDEQIIDLIITLIYSGYETMSTTSMMAVKYLSDHPKALEQLRKEHFDIRKGKAP 320
gi 18406372  238 RKESGETFTDMLGYLMK-KEDNRYLLTDKEIRDQVVTILYSGYETVSTTSMMALKYLHDHPKALEELRREHLAIRERKRP 316
gi 30693327  238 RRDSGETFTDMLGYLMK-KEGNRYPLTDEEIRDQVVTILYSGYETVSTTSMMALKYLHDHPKALQELRAEHLAFRERKRQ 316
gi 242038893 237 RRSSGCAQDDMLDALLSgNEGTRAKLTDDQIIDLLITLIYSGYETVSTTSMMAVKYLSDNPKALEQIRKEHLDIRKAKSP 316
gi 225451804 237 RKASQETHNDMLGCLMR-TNENRYKLSDEEIIDLIITILYSGYETVSTTSMMAVKYLHDHPRVLDELRKEHLAIRERKRP 315
gi 225423426 236 RRASSMTQDDMLGYLLR-NEGSKYNLSDEEILDQVITILYSGYETVSTTSMMAVKYLLDNPRALQQLREEHLAIRQRKNP 314
gi 224077752 237 RRASKLSHQDMLGKLMR-TQENKYKLTDEEIIDQIITILYSGYETVSTTSMMAVKYLHDHPTVLQELRKEHLAVREKKRP 315
gi 224112092 238 RRASSVVHSDILGQIMS-CENQKYHLTDDEMIDQIITMLYSGYETVSTTIMMALKYVHDNPKALQELREEHLAIRARRKP 316
gi 224120652 237 RRASKLYHQDMLGRLMR-TEENKFKLTDEEIIDQIITILYSGYETVSTTSMMAVKYLHDHPRVLQELRKEHFAIREKKRP 315
gi 297815290 238 RRESGETFTDMLGYLMK-KEDNRYLLTDKEIRDQVVTILYSGYETVSTTSMMALKYLHDHPEALEELRREHLAIRERKRP 316
gi 297801724 238 RRDSGETFTDMLGYLMK-KEDNRYPLTDEEIRDQVVTILYSGYETVSTTSMMALKYLHDHPKALLELRTEHLALRESKRP 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115454045 321 EDAIDWNDFKSMTFTRAVIFETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRIYVYTREINYDPFLYPDPMTFNPWRWLE 400
gi 18406372  317 DEPLTLDDIKSMKFTRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRIYVYTREINYDTSLYEDPMIFNPWRWME 396
gi 30693327  317 DEPLGLEDVKSMKFTRAVIYETSRLATIVNGVLRKTTRDLEINGYLIPKGWRIYVYTREINYDANLYEDPLIFNPWRWMK 396
gi 242038893 317 DDALDWNDYKSMTFTKAVIYETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRIYVYTREINYDPFLYPEPMVFNPWRWLE 396
gi 225451804 316 EDPIDWNDYKLMRFTRAVIFETSRLATIVNGVLRKTTKDMELNGFVIPKGWRIYVYTREINYDPLLYPDPLAFNPWRWLD 395
gi 225423426 315 EDPIDWNDYKSMNFTRAVIFETSRLATVVNGVLRKTTKEMELNGFVIPRGWRIYVYTREINYDPFLYPEPYTFNPWRWLD 394
gi 224077752 316 EDPIDLNDLKPMRFTRAVILETSRMATIVNGVLRKTTREMELNGFVIPKGWRIYVYTREINYDPHIYPDPLSFNPWRWLD 395
gi 224112092 317 EDPIDWDDYKGMRFTRAVIFETSRLAAVVNGLLRKTNQDIELNGFLVPRGWRLYVSLREINFDPILYPEPSTFNPRRWMD 396
gi 224120652 316 EDPIDLNDLKSMRFTRAVIFETSRLATIVNGVLRKTTKEMELNRFVIPKGWRIYVYTREINYDPYLYPDPFSFNPWRWLD 395
gi 297815290 317 DEPLTLDDIKSMKFTRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRIYVYTREINYDTSLYEDPMIFNPWRWME 396
gi 297801724 317 DEPLGLEDVKSMKFTRAVIFETSRLATIVNGVLRKTTRDLEINGYLIPKGWRIYVYTREINYDANLYENPLIFNPWRWMK 396
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 115454045 401 KNMESHPHFMLFGGGSRMCPGKEVGTVEIATFLHYFVTQYRWEEEGNNTILKFPRVEAPNGLHIRVQDY 469
gi 18406372  397 KSLESKSYFLLFGGGVRLCPGKELGISEVSSFLHYFVTKYRWEENGEDKLMVFPRVSAPKGYHLKCSPY 465
gi 30693327  397 KSLESQNSCFVFGGGTRLCPGKELGIVEISSFLHYFVTRYRWEEIGGDELMVFPRVFAPKGFHLRISPY 465
gi 242038893 397 TNLESHPHFMLFGGGARMCPGKEVGTVEIATFLHYFITRYRWEEEGNNTISKFPRVAAPNGLHIRVQDY 465
gi 225451804 396 KSLESQNYFLLFGGGTRQCPGKELGIAEISTFLHYFVTRYRWEEVGGDKLMKFPRVEAPNGLHIRVSAY 464
gi 225423426 395 NSLESHNYCFTFGGGTRLCPGKELGIVQISTFLHYFLTSYRWEEVGSNKIVKFPRVEAPNGLHIRVSKY 463
gi 224077752 396 KSLESQNYLFIFGGGARQCPGKELGIAEISTFLHYFVTRYRWEEVGGDTLMKFPRVEAPNGLHIRVSSH 464
gi 224112092 397 NGLENHNYCFVFGGGTRLCPGKELGMVKIATFLHYFVTQYRWEESEGIEIVKFPRVEARNGLPIRVSKY 465
gi 224120652 396 KSLESQNYLFIFGGGTRQCPGKELGIAEISTFLHYFVTRYRWEEVGGDSLMKFPRVEAPNGLHIRVSSH 464
gi 297815290 397 KSLESKSYFLLFGGGARLCPGKELGISEVSSFLHYFVTKYRWEENGEDKLMVFPRVSAPKGYHLKCSPY 465
gi 297801724 397 KSLESQNSCFVFGGGTRLCPGKELGIVEISSFLHYFVTRYRWEEIGGDELMVFPRVFAPKGFHLRISPY 465
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap