NCBI CDD Logo
?
PLN00110: PLN00110 
flavonoid 3',5'-hydroxylase (F3'5'H); Provisional
Links
?
Statistics
?
PSSM-Id: 177725
View PSSM: PLN00110
Aligned: 12 rows
Threshold Bit Score: 987.041
Threshold Setting Gi: 225436666
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:

PLN00110 is a member of the superfamily cl12078.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 224105985   1 MVL-LWELTMAALFFFINYLLTRCL--IRKLSTRqLPPGPRGWPIIGAIPVLGAMPHAALAKMAKQYGPVMYLKMGTCNM 77
gi 224105987   5 MVL-LWELTMAALFFFINYLLTRCL--IRKLSTRqLPPGPRGWPIIGAIPVLGAMPHAALAKMAKQYGPVMYLKMGTCNM 81
gi 224055291   5 PVL-PGKLTLAALLFFISYQFTGSF--IRKLLHR-YPPGPRGWPIIGAIPLLGDMPHVTLAKMAKKHGPVMYLKMGTRDM 80
gi 225466541   5 TSL-LPELAAATLLFFITRFFIRSL--FPKPSRK-LPPGPRGWPLLGALPLLGNMPHVALAKMAKRYGPVMFLKMGTNSM 80
gi 225467596   5 TSL-LLELAAATLLFFITRFFIRSL--LLKSSRK-LPPGPKGWPLVGALPLLGNMPHVALAKMAKRYGPVMFLKMGTNSM 80
gi 225467598  10 TSL-LLELAAATLLFFITRFFIRSL--LLKSSRK-LPPGPKGWPLVGALPLLGNMPHVALAKMAKRYGPVMFLKMGTNSM 85
gi 225469434   5 TSL-LLKLAAAILLFFITRFFIRSL--LPKPSRK-LPPGPRGWPLLGALPLLGNMPHVALAKMAKRYGPVMFLKMGTNCM 80
gi 225469436  10 TSL-LLKLAAAILLFFITRFFIRSL--LPKPSRK-LPPGPRGWPLLGALPLLGNMPHVALAKMAKRYGPVMFLKMGTNCM 85
gi 225436670   5 TSL-LPELAAATLLFFITRFFICSL--FPKPSRK-LPPGPRGWPLLGALPLLGNMPHVALAKMAKRYGPVMFLKMGTSSM 80
gi 225436672   5 TSL-LPELAAATLLFFITRFFIRSL--FPKPSRK-LPPGPRGWPLLGALPLLGNMPHVALAKMAKRYGPVMFLKMGTNSM 80
gi 225436666   5 TSF-FIVSAAATLLFLIVHSFIHFL--VSRRSRK-LPPGPKGWPLLGVLPLLKEMPHVALAKMAKKYGPVMLLKMGTSNM 80
gi 225441222   5 TMVqIDELLFTALVFLVTNFFVKRItsMSRSSRR-LPPGPRGWPVVGCLPLLGAMPHVALAQLAQKYGAIMYLKLGTCDV 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 224105985  78 VVASTPDAARAFLKTLDLNFSNRPPNAGATHLAYNAQDMVFADYGPRWKLLRKLSNLHMLGGKALEDWAHVRVSELGHML 157
gi 224105987  82 VVASTPDAARAFLKTLDLNFSNRPPNAGATHLAYNAQDMVFADYGPRWKLLRKLSNLHMLGGKALEDWAHVRVSELGHML 161
gi 224055291  81 VVASNPDAARAFLKTLDLNFSNRPIDGGPTHLAYNAQDMVFADYGPRWKLLRKLSNLHMLGGKALEDWAPVRVTELGHML 160
gi 225466541  81 VVASTPEAARAFLKTLDINFSNRPPNAGATHLAYGAQDMVFADYGPRWKLLRKLSNLHMLGGKALEDSSQVRTVELGHML 160
gi 225467596  81 VVASTPGAARAFLKTLDINFSNRPPNAGATLLAYHAQDMVFADYGARWKLLRKLSNLHMLGGKALEDWSQVRAVELGHML 160
gi 225467598  86 VVASTPGAARAFLKTLDINFSNRPPNAGATLLAYHAQDMVFADYGARWKLLRKLSNLHMLGGKALEDWSQVRAVELGHML 165
gi 225469434  81 VVASTPEAAQAFLKTLDINVSNRPPNAGATHLAYDAQDMVFADYGPRWKLLRKLSNLHMLGGKALEDWSQVRTVELGHML 160
gi 225469436  86 VVASTPEAAQAFLKTLDINVSNRPPNAGATHLAYDAQDMVFADYGPRWKLLRKLSNLHMLGGKALEDWSQVRTVELGHML 165
gi 225436670  81 VVASTPEAARAFLKTLDINFSNRPPNAGATHLAYGAQDMVFADYGPRWKLLRKLSNLHMLGGKALEDSSQVRTVELGHML 160
gi 225436672  81 VVASTPEAARAFLKTLDINFSNRPPNAGATHLAYDAQDMVFADYGARWKLLRKLSNLHMLGGKALEDWSQVRTVELGHML 160
gi 225436666  81 VVASNPEAAQAFLKTHEANFLNREPGAATSHLVYGCQDMVFTEYGQRWKLLRRLSTLHLLGGKAVEGSSEVRAAELGRVL 160
gi 225441222  84 VVASKPDSARAFLKTLDLNFSNRPPNAGATHIAYEAQDFVFADIGPRWNLLRKLTSLHMLGAKSFKDWGAIRGAEIGHMI 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 224105985 158 RAMCEASRKGEPVVVPEMLTYAMANMIGQIILSRRVFVTKGSESNEFKDMVVELMTSAGLFNVGDYIPSVAWMDLQGIER 237
gi 224105987 162 RAMCEASRKGEPVVVPEMLTYAMANMIGQIILSRRVFVTKGSESNEFKDMVVELMTSAGLFNVGDYIPSVAWMDLQGIER 241
gi 224055291 161 RAMCEASRKGDPVVVPEMLTYAMANMIGQIILSRRVFVTKGSESNEFKDMVVELMTSGGFFNIGDFIPSVAWMDLQGIER 240
gi 225466541 161 RAMLELSQREEPVVVPEMLSFSIANIIGQVILSRRVFETKGSESNEFKDMVVELMTCAGYFNIGDFIPSIAWMDIQGIER 240
gi 225467596 161 RAMLELSQRAEPVVVPEMLTFSMANMIGQVILSRRVFETKGSESNEFKDMVVELMTTAGYFNIGDFIPSIAWLDIQGIQR 240
gi 225467598 166 RAMLELSQRAEPVVVPEMLTFSMANMIGQVILSRRVFETKGSESNEFKDMVVELMTTAGYFNIGDFIPSIAWLDIQGIQR 245
gi 225469434 161 RAMLELSQREEPVVVPEMLSFSVANMIGQVILSRRVFETKGSESNEFKDMVVELMTTAGYFNIGDFIPSIAWLDIQGIER 240
gi 225469436 166 RAMLELSQREEPVVVPEMLSFSVANMIGQVILSRRVFETKGSESNEFKDMVVELMTTAGYFNIGDFIPSIAWLDIQGIER 245
gi 225436670 161 RAMLELSQREEPVVVPEMLSFSIANIIGQVILSRRVFETKGSESNEFKDMVVELMTCAGYFNIGDFIPSIAWMDIQGIER 240
gi 225436672 161 RAMLELSQREEPVVVPEMLSFSVANMIGQVILSRRVFETKGSESNEFKDMVVELMTTAGYFNIGDFIPSIAWLDIQGIER 240
gi 225436666 161 QTMLEFSQRGQPVVVPELLTIVMVNIISQTVLSRRLFQSKESKTNSFKEMIVESMVWAGQFNIGDFIPFIAWMDIQGILR 240
gi 225441222 164 QAMCELSRRGEPVVVPEMVSCALANIIGQKSLSRRVFETQGSESNDFKEMVVELMRLAGLFNVGDFIPSIAWMDLQGTEG 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 224105985 238 GMKRLHRRFDVLLTKMMEEHIATAHERKGKPDFLDVLMANQEN-LDGEKLSFTNIKALLLNLFTAGTDTSSSIIEWSLAE 316
gi 224105987 242 GMKRLHRRFDVLLTKMMEEHIATAHERKGKPDFLDVLMANQEN-LDGEKLSFTNIKALLLNLFTAGTDTSSSIIEWSLAE 320
gi 224055291 241 GMKKLHRRFDVLLTKMIEDHSATSHERKGKPDFLDVLMANQEN-SDGARLCLTNIKALLLDLFTAGTDTSSSVIEWALAE 319
gi 225466541 241 GMKHLHKKFDKLLTRMIEEHTASAHERKGNPDFLDVVMGHQEN-TTGEKLTLSNIKALLQNLFAAGTDTSASIIEWSLAE 319
gi 225467596 241 GMEHLHRKFDWLLTKMMEEHTASAHERKGNPDFLDVIMANQEN-STGEKLTITNIKALLLNLFTAGTDTSSSVIEWSLAE 319
gi 225467598 246 GMEHLHRKFDWLLTKMMEEHTASAHERKGNPDFLDVIMANQEN-STGEKLTITNIKALLLNLFTAGTDTSSSVIEWSLAE 324
gi 225469434 241 GMKHLHKKFDKLLTRMIEEHTASAHERKGNPDFLDVVMGHQGN-STGEKLTLTNIKALLLNLFTAGTDTSSSVIEWSLAE 319
gi 225469436 246 GMKHLHKKFDKLLTRMIEEHTASAHERKGNPDFLDVVMGHQGN-STGEKLTLTNIKALLLNLFTAGTDTSSSVIEWSLAE 324
gi 225436670 241 GMKHLHKKFDKLLTRMIEEHTASAHERKGNPDFLDVVMGHQEN-TTGEKLTLSNIKALLQNLFAAGTDTSASIIEWSLAE 319
gi 225436672 241 GMKHLHKKFDKLLTRMIEEHTASAHERKGNPDFLDVVMGHQGN-STGEKLTLTNIKALLLNLFTAGTDTSSSVIEWSLAE 319
gi 225436666 241 QMKRVHKKFDKFLTELIEEHQASADERKGKPDFLDIIMANQEDgPPEDRITLTNIKAVLVNLFVAGTDTSSSTIEWALAE 320
gi 225441222 244 KMKLLHNKFDALLTRMIEEHSATAHERLGNPDILDVVMAEQEY-SGGVKLSMVNIKALLLNLFIAGTDTSSGTIEWALAE 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 224105985 317 MLKNPRILKQAQDEMDQVIGRNRRLEESDIPKLPYLQAICKETFRKHPSTPLNLPRIADQACEVNGYYIPKGTRLSVNIW 396
gi 224105987 321 MLKNPRILKQAQDEMDQVIGRNRRLEESDIPKLPYLQAICKETFRKHPSTPLNLPRIADQACEVNGYYIPKGTRLSVNIW 400
gi 224055291 320 MLKNQSILKRAQEEMDQVIGRNRRLVESDIPKLPYLQAVCKETFRKHPSTPLNLPRIADQACEVNGYYIPKGARLSVNIW 399
gi 225466541 320 MLKNPSILKRAQEEMDHVIGRNRRLVESDLPKLPYLQAICKESLRKHPSTPLNLPRVSTQACEVNGYYIPENTRLSVNIW 399
gi 225467596 320 MLKNPSILKRAHEEMDKVIGRSRRLVESDLPKLPYLQAICKESFRKHPSTPLNLPRVSTQACEVNGYYIPENTRLSVNIW 399
gi 225467598 325 MLKNPSILKRAHEEMDKVIGRSRRLVESDLPKLPYLQAICKESFRKHPSTPLNLPRVSTQACEVNGYYIPENTRLSVNIW 404
gi 225469434 320 MLKNPSILKRAHEEMDQVIGRSRRLVESDLPKLPYLQAICKESFRKHPSTPLNLPRVSAQACEVNGYYIPKNTRLSVNIW 399
gi 225469436 325 MLKNPSILKRAHEEMDQVIGRSRRLVESDLPKLPYLQAICKESFRKHPSTPLNLPRVSAQACEVNGYYIPKNTRLSVNIW 404
gi 225436670 320 MLKNPSILKRAQEEMDHVIGRNRRLVESDLPKLPYLQAICKESLRKHPSTPLNLPRVSTQACEVNGYYIPENTRLSVNIW 399
gi 225436672 320 MLKNPSILKRAHEEMDQVIGRSRRLVESDLQKLPYLQAICKESFRKHPSTPLNLPRVSNEACEVNGYYIPKNTRLSVNIW 399
gi 225436666 321 MLKKPSIFQRAHEEMDQVIGRSRRLEESDLPKLPYLRAICKESFRLHPSTPLNLPRVASEACEVNGYYIPKNTRVQVNIW 400
gi 225441222 323 ILKNPTMLKRAHAEMDRVIGKNRLLQESDVPKLPYLEAICKETFRKHPSVPLNIPRVSANACEVDGYYIPEDTRLFVNVW 402
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 224105985 397 AIGRDPDVWDNPLDFTPERFFSEKYAKINPQGNDFELIPFGAGRRICAGTRMGIVLVQYILGTLVHSFDWKLPKDVELNM 476
gi 224105987 401 AIGRDPDVWDNPLDFTPERFFSEKYAKINPQGNDFELIPFGAGRRICAGTRMGIVLVQYILGTLVHSFDWKLPKDVELNM 480
gi 224055291 400 AIGRDPDVWDNPEVFTPERFFTEKYAKINPRGNDFELIPFGAGRRICAGARMGIVLVEYILGTLVHSFDWKLPEDVDLNM 479
gi 225466541 400 AIGRDPDVWENPEEFRPERFLSGRNAKIDPRGNDFELIPFGAGRRICAGARMGIVLVEYILGTLVHSFDWKIPDGVEINM 479
gi 225467596 400 AIGRDPDVWESPEEFRPERFLSGRNEKIDPRGNDFELIPFGAGRRICAGTRMGIVLVEYILGTLVHSFDWKMPDGVEINM 479
gi 225467598 405 AIGRDPDVWESPEEFRPERFLSGRNEKIDPRGNDFELIPFGAGRRICAGTRMGIVLVEYILGTLVHSFDWKMPDGVEINM 484
gi 225469434 400 AIGRDPDVWESPEEFRPERFLSGRNAKIDPRGNDFELIPFGAGRRICAGTRMGIVLVEYILGSLVHSFDWKMPDGVEINM 479
gi 225469436 405 AIGRDPDVWESPEEFRPERFLSGRNAKIDPRGNDFELIPFGAGRRICAGTRMGIVLVEYILGSLVHSFDWKMPDGVEINM 484
gi 225436670 400 AIGRDPDVWENPEEFRPERFLSGRNAKIDPRGNDFELIPFGAGRRICAGARMGIVLVEYILGTLVHSFDWKMPDGVEINM 479
gi 225436672 400 AIGRDPDVWESPEEFSPERFLSGRNAKIDPRGNDFELIPFGAGRRICAGTRMGIVLVEYILGTLVHSFDWKMPDGVEINM 479
gi 225436666 401 AIGRDPDVWENPEDFAPERFLSEKHANIDPRGNDFELIPFGSGRRICSGNKMAVIAIEYILATLVHSFDWKLPDGVELNM 480
gi 225441222 403 AIGRDPEVWENPLEFKPERFLSEKNARISPWGNDFELLPFGAGRRMCAGIRMGIEVVTYALGTLVHSFDWKLPKGDELNM 482
                        490       500
                 ....*....|....*....|....*....
gi 224105985 477 DEVFGLALQKAVPLSAMVTPRLEPNAYLA 505
gi 224105987 481 DEVFGLALQKAVPLSAMVTPRLEPNAYLA 509
gi 224055291 480 DEVFGLALQKAVPLSAMVSPRLEPNAYLA 508
gi 225466541 480 DEAFGLALQKAVSLSAMVTPRLHQSAYAV 508
gi 225467596 480 DEAFGLALQKAVSLSAMVTPRLHQSAYAV 508
gi 225467598 485 DEAFGLALQKAVSLSAMVTPRLHQSAYAV 513
gi 225469434 480 DEAFGLALQKAVSLSAMVTPRLHQSAYAV 508
gi 225469436 485 DEAFGLALQKAVSLSAMVTPRLHQSAYAV 513
gi 225436670 480 DEAFGLALQKAVSLSAMVTPRLHQSAYAV 508
gi 225436672 480 DEAFGLALQKAVSLSAMVTPRLHQSAYAV 508
gi 225436666 481 DEGFGLTLQKAVPLLAMVTPRLELSAYAA 509
gi 225441222 483 DEAFGLVLQKAVPLSAMVTPRLHPSAYKA 511
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap