Conserved Protein Domain Family
thiamin_ThiO

?
TIGR02352: thiamin_ThiO 
Click on image for an interactive view with Cn3D
glycine oxidase ThiO
This family consists of the homotetrameric, FAD-dependent glycine oxidase ThiO, from species such as Bacillus subtilis that use glycine in thiamine biosynthesis. In general, members of this family will not be found in species such as E. coli that instead use tyrosine and the ThiH protein [Biosynthesis of cofactors, prosthetic groups, and carriers, Thiamine].
Statistics
?
PSSM-Id: 162817
View PSSM: TIGR02352
Aligned: 13 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 11-Sep-2012
Updated: 15-Oct-2012
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

TIGR02352 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1RYI_A        34 YYLAKENKNTALFESGt-mGGRTTSAAA-GMLGAHAECE-ERDAFFDFAMHSQRLYKGLGEELYALSGVDIRQHNGGMFK 110
gi 47501162   21 HFLAERGHKVAIVEKQq-iASEASKAAA-GLLGVQAEWD-EYDPLFDLARESRAIFPQLAEVLREKTGIDIGYEEKGIYR 97
gi 6016135    21 YYLAKENKNTALFESGt-mGGRTTSAAA-GMLGAHAECE-ERDAFFDFAMHSQRLYKGLGEELYALSGVDIRQHNGGMFK 97
gi 18202565   21 VELKLKQKRLQVTVLSrdfAQAASHAAA-GMLAPHAEQI-APGPMLDLCLASRWRYGEWVEKLEQLTGMETGYNPCGILS 98
gi 23493775   18 VRLADAGHVVTLVDPDp--ASGATHHAG-GMLAPVAEVVyRQEALFPLMLRSAALYPGLLRVVDKHTDLPTGYRTEGTLV 94
gi 38198931   17 FELSSRGHSVHVFDPNp--ASGASHFAG-GMLAPAAEVQfQQDPLFPLMKRAGKLWPDMVRRVAQRTNLPTGYRTEGTLV 93
gi 31617179   24 RRAAQAGWPVRVHRSD---ERGASWVAG-GMLAPHSEGWpGEERLLRLGLQSLRLWREGSFLDGLGPQLVTAH---ESLV 96
gi 206583829  19 WQLSKVGFGVTLFDKDdksGQKSTAYAAaGMLSPVAECEiAEQIIFNLGSYSLRKWPLWLSSL----NQPVYFKQNGSIV 94
gi 7388300    17 WQLYRHGFRVTLAERAgtvGAGASGFAG-GMLAPWCEREsAEEPVLTLGRLAADWWEAAL---------PGHVHRRGTLV 86
gi 30180256   19 LRLLEEGASVTLLDRRe-aGCEASWAGG-GILSPLYPWN-YSDSVTRLAAYSMSRYPEWTAALNTATGIDPEYQICGLVI 95
gi 15613997   15 FELKVRGHQVTVLEQGl-cGGQASGAAA-GMLAPFSEIGeDPNDFFHLAHESLKMYPDWQQAVKEISGKSFEYVQSGSLH 92
gi 24419021   34 WRAARRGLVTALVDPEp--GGGAAQVAA-GMLAAVTELHyGEETLLALNLASARRYPEFAAELTELTGHDLGYRRCGTLA 110
gi 15606107   17 VELLLAGHDVRLLVRDk--REGASWVAG-GMLAPFSEG--LRGDFLRFSVESLRLWHDYLERLKEISGRKVFFSQ-GILR 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1RYI_A       111 LAFSEEDVLQLRQMDDLDS------VSWYSKEEVLEKEPYASGDIFGASFIQDDVHVEPYFVCKAYVKAAKMLGAEIFEH 184
gi 47501162   98 IAQNEDEKERILHIMDWQQktg-edSYFLTGDRLREQEPYLSESIIGAVYYPKDGHVIAPELTKAFAHSAAISGADIYEQ 176
gi 6016135    98 LAFSEEDVLQLRQMDDLDSv------sWYSKEEVLEKEPYASGDIFGASFIQDDVHVEPYFVCKAYVKAAKMLGAEIFEH 171
gi 18202565   99 PVFEAPHGNSSTNSAWLDQe------------tIRYYQPGLGEDVIGGWWHPDDGQVDNRKLVSALRQAAQSLGVQIQEG 166
gi 23493775   95 VAADRADAAHLAQLSDYQSang-meVERLTLRAARRLEPALSPQLAGAVHIPGDHQINPRMFAAALLDALDNLGVEVRR- 172
gi 38198931   94 VAADRADAEHLKQLRATQEaag-mdVRPITTRQARGLEPALGPRLSAAVHIPNDTQVAPRVFLTALLDALDDCGVGVIK- 171
gi 31617179   97 VAVDRADVADLRTVADWLSaqg-hpVIWES--AARDVEPLLAQGIRHGFRAPTELAVDNRALLDVLCRDCERLGVRWSSq 173
gi 206583829  95 ISHSHDEVEKERWLKQISRkikdfsLEKLSSSALQRLEPELN--FDEGYYLPQEAHLDSRALMQTLEKELNVEWHSKTF- 171
gi 7388300    87 VAGGRDTGELDRFSRRTSg------WEWLDEVAIAALEPDLAGRFRRALFFRQEAHLDPRQALAALAAGL---------- 150
gi 30180256   96 LPPCDPEAAVNWCSAHAVRlt---yLSSSHHGGLSWAHINDEQGNAQALFLPEVAQVRNPRLLQALYKRIRQLGGKIIEH 172
gi 15613997   93 CVYHEADFLELESRQHWQGtfg-veSEILSQQQIRALEPNISDEIIGAIYYPEESHLFAPDYVKALEIGCRKLGVTIEDE 171
gi 24419021  111 VALDADDRAHLRELHALQQrsg-leSEWLSGRECRRLEPMLAPGVRGGLRVDGDHQIDPRRLARALVAACEHAGVVFHRV 189
gi 15606107   91 VAFDEKEEKKLREDVKFYSqevcqnLISYDAEELLKEFPYLSSEVRYGVIYGDEGNVDTEELMEALYVAFEKLGGEIINE 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1RYI_A       185 TPVLHVERDGE-ALFIKTPSG-DVWANHVVVASGVWSGMFFK------QLGLNNAFLPVKGECLS--VWNDDIPLTKTLY 254
gi 47501162  177 TEVFDIRIENKkVIGIVTSEG-MISCEKVVIAGGSWSTKLLG------YFHREWGTYPVKGEVVA--VKSRKQLLKAPIF 247
gi 6016135   172 TPVLHVERDGE-ALFIKTPSG-DVWANHVVVASGVWSGMFFK------QLGLNNAFLPVKGECLS--VWNDDIPLTKTLY 241
gi 18202565  167 VTVQAIAQRHGqVTAVLTDQG-SFQADSYVLANGSWAKELLP------LPVFPVKGQMMALRMPA--GTHQPYPLQRVLF 237
gi 23493775  173 ----------ErATAIP-------DDEQVVLANGLGAGQLHp-----gLQLRPVYGDILRLGVPDhlAPLLTRVVRGFVE 230
gi 38198931  172 ----------EkITDLEPLY---QQFDVVVLAAGLGAQHLSpi----pLALRPVRGDILRVQTe---PGAVNMVVRGWVN 231
gi 31617179  174 ------------VSSLS-----DVDAHTVVIANGIDAPALWp-----gLPIRPVKGEVLRLRWRPgcMPLPQRVIRARVR 231
gi 206583829 172 -----VESVVPyRILTKGKS---YQFDCIFDCRGTGAGEMFS------D-LRSVRGELIYLHAP---DVRLNRPIRLLHP 233
gi 7388300   151 -----EDARMRlTLGVVGESD--VDHDRVVDCTGAAQIGRLP------G-LRGVRGEMLCVETT---EVSLSRPVRLLHP 213
gi 30180256  173 CEVQELEISGQkVHAIRTPSE-KHSADQYILSAGAWSRKILGeha-lnLAIKPIRGQMLLYRLP-------GNPLCSIVL 243
gi 15613997  172 VGHISIEAWMEhQVLRGPSGK-QWAGDRLIVCAGAWASEHEE------TFSLRVPVYPIRGQICA--YEVPAGDVRHIVY 242
gi 24419021  190 WAERLTVGRGDrATGVVGADGtALEAGQVVLAGGSLSGRLGGvpeavlPPVRPVKGQVLRLTMPRtpGPLLNRTVRAVVR 269
gi 15606107  171 DAVKILRN-GErIEKVFGFFE-EFTADYYVFATGAWLKEHFG------FPVFPVKGQILRVEAP---------LKDYVVY 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1RYI_A       255 HDHCYIVPRKSGRLVVGATMKPGDWSETPDLGGLESVMKKAKTMLPAIQNMKVDRFWAGLRPGTKDGKPYIGRHPEDSrI 334
gi 47501162  248 QERFYIAPKRGGRYVIGATMKPHTFNKTVQPESITSILERAYTILPALKEAEWESTWAGLRPQSNHEAPYMGEHEEIKgL 327
gi 6016135   242 HDHCYIVPRKSGRLVVGATMKPGDWSETPDLGGLESVMKKAKTMLPAIQNMKVDRFWAGLRPGTKDGKPYIGRHPEDSrI 321
gi 18202565  238 GPQTYLVPRRDGRLIVGATSEQVDWQPHNTPQGIQTLLGRAIRLFPALGDWAIEDFWWGFRPGTPDEQPFLGYGPCDN-L 316
gi 23493775  231 DRTVYLIPRTDGTLAIGATSREDERP-VPRAGAVHDLLRDATRLAPGIKECDFLEATTGARPGTPDDLPYLG-RVDER-L 307
gi 38198931  232 DRPIYIIPRANGEIAIGATSREDERD-LPSVEGIYDLLRDAIRVVPGIVDSSLIEANVGVRPGTPDDLPYLG-WASDR-L 308
gi 31617179  232 GRQVYLVPRSDG-VVVGATQYEHGRDTAPVVSGVRDLLDDACTVLPALGEYELAECEAGLRPMTPDNLPLVQ-RLDSR-T 308
gi 206583829 234 RYRLYIVPRAHHIYLIGASEIESNDISPISVRTCLELLSAVYSVHPAFAEARIIETVTALRPALSDNLPRIH---YQPgL 310
gi 7388300   214 RHPIYIVPRDKNRFMVGATMIESDDGGPITARSLMELLNAAYAMHPAFGEARVTETGAGVRPAYPDNLPRVT---QEGrT 290
gi 30180256  244 QRDLYLIPRRDGHLLVGSTIEDTGFDKQITLDAKNRLSSWAEEILPQLKNTPLLKHWSGLRPATPDNIPIIGPHPFLEnL 323
gi 15613997  243 TSQGYIVPKGNGTVVNGASEDIAGYDTTVTEQGIKRLTNWNGHIFPFLNELTPFHTWAGLRPATQDGYPMIGETKKAPhV 322
gi 24419021  270 GNHVYLVPRESGELVVGATSEELGWDTTVTAGGVYELLRDAHELVPGITELPLTETRAGLRPGSPDNAPLLGPTALDG-L 348
gi 15606107  234 SSRAYIIPREKD-LLIGATTENAGFDTKTTLEGVKKLSEGAISSVPQLKEAQLLEVRVGFRPGTPDELPVFYFGENFS-- 310
                        330       340
                 ....*....|....*....|....*....
1RYI_A       335 LFAAGHFRNGILLAPATGALISDLIMNKE 363
gi 47501162  328 YACTGHYRNGILLSPVSGQYMADLIEGKQ 356
gi 6016135   322 LFAAGHFRNGILLAPATGALISDLIMNKE 350
gi 18202565  317 ILAIGHYRNGILLAPITAALISDLILDQK 345
gi 23493775  308 IISTGYFRHGILLTALAAEATLAMVEHRD 336
gi 38198931  309 IISTGYFRHGILLSALGAHVTACLIDGTD 337
gi 31617179  309 LVAAGHGRSGFLLAPWTAEQIVSELVSVG 337
gi 206583829 311 IAINGLYRHGFLVAPALIDEVIHNLSRGI 339
gi 7388300   291 LHVNGLYRHGFLLAPAMAGEVARRLLTEQ 319
gi 30180256  324 YINSGHFRYGVTMAPGSAEILVNEILKRT 352
gi 15613997  323 VFATGHYRNGILLSPITAKVVADVVEGKK 351
gi 24419021  349 LLATGHYRNGVLLTPVTGDVMAEALTGGE 377
gi 15606107  311 -VYGGHYRNGILLAPATAEVALKLIDQGE 338
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap