Conserved Protein Domain Family
Jnk-SapK_ap_N

?
pfam09744: Jnk-SapK_ap_N 
JNK_SAPK-associated protein-1
This is the N-terminal 200 residues of a set of proteins conserved from yeasts to humans. Most of the proteins in this entry have an RhoGEF pfam00621 domain at their C-terminal end.
Statistics
?
PSSM-Id: 150420
View PSSM: pfam09744
Aligned: 7 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Dec-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
pfam09744 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74775177    20 VYHLAQIIYHEFEVMRRVFGESAYKTLVPIVIGILEEMDLLTVDKQ-KLDLDFNLLTAEKNDISVQLCRQKELYTAAKRH 98
gi 223590089   42 VQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQ-EQDVELELLREDNEQLVTQYEREKSARKQSEQK 120
gi 145559484   29 VSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQ-EHEVELELLREDNEQLLTQYEREKALRRQAEEK 107
gi 82260774    23 VSGLANSIYREFERLIGKYDEDVVKELMPLVVAVLENLDSVFAENQ-EHEVELELLKEDNEQLITQYEREKALRKHAEEK 101
gi 122059093   32 VQDLANDIYKEFESLIKLYGNGFLHNLMPLVIRALENLDSLHSENS-NLHLKALVLSDDHRLLSGEYEKEKKLRKVAENK 110
gi 75016698    11 VYDLAASIGNDFEKLIDNYGNECVRGIMPKVISALETLEAMAAGND--------RENEEIMRLSKAVERLEQEKHQRNQQ 82
gi 158512482   19 VYDIASAVGQEFERVIDQYGCEVIGRLMPKVVRVLEILEVLVSRNHiNPEMEELRLELDRLRLERMDRIEKEKKHQKELE 98
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 74775177    99 IHCLEDELFGMKKEADKKLEELEENLRHYQLLAKNANDHVFRLEEREQDLRSELSAQNERYTKLLKIYVDYIETNNLSV 177
gi 223590089  121 LLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEERETDLKKEYNKLHERYTELFKNHVDYMERTKMLM 199
gi 145559484  108 FIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSKMQQ 186
gi 82260774   102 FIEFEDVHEQDKKDLQSHVDRMESHSRQLELKIKNYADQIGRLEEREVELKKEYNSLHQRHTEMIHNYMEHVERIKLQQ 180
gi 122059093  111 LFHLEDDMEEERKQYEEKIATCDANVRILENKVKSLHEQISRFEEQETEMKREYQRLHDLYTNLLRAYLEYVERVRSMF 189
gi 75016698    83 HLKFEEELEQVEKTYRKDIDDLQQMVKSLVNENRNLSTTVSSLPNHADS--PVSTSMREADLKMLLELKEMSSQQKDEI 159
gi 158512482   99 LV--EDVWRGEAQDLLNQIAQLQEENKQLV---SNLSQKDINLTEEEFQ---KHEGMSERERQVMKKLKEVVDKQRDEI 169
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap