Conserved Protein Domain Family
Talin_middle

?
pfam09141: Talin_middle 
Click on image for an interactive view with Cn3D
Talin, middle domain
Members of this family adopt a structure consisting of five alpha helices that fold into a bundle. They contain a Vinculin binding site (VBS) composed of a hydrophobic surface spanning five turns of helix four. Activation of the VBS causes subsequent recruitment of Vinculin, which enables maturation of small integrin/talin complexes into more stable adhesions. Formation of the complex between VBS and Vinculin requires prior unfolding of this middle domain: once released from the talin hydrophobic core, the VBS helix is then available to induce the 'bundle conversion' conformational change within the vinculin head domain thereby displacing the intramolecular interaction with the vinculin tail, allowing vinculin to bind actin.
Links
?
Statistics
?
PSSM-Id: 149993
View PSSM: pfam09141
Aligned: 7 rows
Threshold Bit Score: 240.107
Threshold Setting Gi: 156402925
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam09141 is a member of the superfamily cl07673.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SJ7_A         10 AQQALTGTINSSMQAVQAAQATLDDFET--LPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAET 87
gi 81175199   491 AQQALTGTINSSMQAVNAAQATLDDFET--LPPLGQDAASKAWRKNKMDESKHEIHSQADAITAGTASVVNLTAGDPADT 568
gi 75020100   525 PQRALIGTIEATIRAVEDAEIELEAEPQidIPRFNDDYSQNRWMEEQQAVNKENVNERLAAMGAATAQVVQWTAVEEYD- 603
gi 122072928  510 PQRALLGYISAGQDVLIRADEELRTKAP--IQELGSDLRSIEWRENTLDTSKQAVSSHVATMSAATAQII--TASQPDEV 585
gi 122106156  536 PQRALVGYISAGQDAINKAEKDLESKAQ--LPPLGTDPGSMQWREETLDTSKQTVTTHLATMNAATAQVV--TASQPDEI 611
gi 156402925  505 AQQAYMSSLSQGIDSVDTADEELKRPVN--IVALGSDPASLKWKQNTLDVSRQNVASRLAALSASCASIVNVTSGEPGDT 582
gi 342187133  495 AQQALMGTINTSMHAVQQAQDDLSELDS--LPPLGQDMASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAGDPADT 572
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SJ7_A         88 DYTAVGCAVTTISSNLTEMSRGVKLLAALLEDEgG-NGRPLLQAAKGLAGAVSELLRSAQPAS---AEPRQNLLQAAGNV 163
gi 81175199   569 DYTAVGCAVTTISSNLTEMSKGVKLLAALMEDE-GgNGRQLLQAAKNLASAVSDLLKTAQPAS---AEPRQNLLQAAGLV 644
gi 75020100   604 --DRVGTAIATIGSNLPDVSRNVRDLGAFMEHR---ERGDLLDATKKLCGAFGKFLNTVNPET---EARRNEVFRTAGHV 675
gi 122072928  586 DTEAISASVSQIAQTIPEVTREVRLIAALMEND-T-NGDQLLEAARNLCNAFSDLLKAAEPES---KEPPQNLINAASRV 660
gi 122106156  612 DHDAVGAAVSQITQSIPEVTKEVRLIAALMDDD-C-TGDKLLEATRKLCSAFSDLLKSAEPES---KEPRQNLLNAASRV 686
gi 156402925  583 NYTAAGAAVHVISANLQDLSKGIKLIAGLLDNQ-D-DSSKLLDAARGLAGAFSLLLKAAQEGAggdKEKRSQLLNAAGNV 660
gi 342187133  573 DYTAVGCAITTISSNLTEMSKGVKLLAALMDDD-VgSGEDLLRAARTLAGAVSDLLKAVQPTS---GEPRQTVLTAAGSI 648

                  ....*...
1SJ7_A        164 GQASGELL 171
gi 81175199   645 GQTSGELL 652
gi 75020100   676 GETSQHLI 683
gi 122072928  661 GEATTHVL 668
gi 122106156  687 GEASGQVL 694
gi 156402925  661 GSSGAQLL 668
gi 342187133  649 GQASGDLL 656
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D