NCBI CDD Logo
?
pfam04803: Cor1 
Cor1/Xlr/Xmr conserved region
Cor1 is a component of the chromosome core in the meiotic prophase chromosomes. Xlr is a lymphoid cell specific protein. Xlm is abundantly transcribed in testis in a tissue-specific and developmentally regulated manner. The protein is located in the nuclei of spermatocytes, early in the prophase of the first meiotic division, and later becomes concentrated in the XY nuclear subregion where it is in particular associated with the axes of sex chromosomes.
Links
?
Statistics
?
PSSM-Id: 147120
View PSSM: pfam04803
Aligned: 12 rows
Threshold Bit Score: 132.497
Threshold Setting Gi: 156390294
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:

pfam04803 is a member of the superfamily cl04763.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130337     60 NKRLHIKRKRMETYIKDSFKDSNVKLEQLWKTNKQERKKINNKFCEQYITTFQKFDMDVQKFNEEQEKSVNNYQKEQQAL 139
gi 81905946  148 NRALSAKRQRMETTARQSFEGVEQKMKEVWNSHEDAMAQLNEESAQAFANLFEQWNEDFKKFREQHEKLVNDFKQQEKIF 227
gi 81868643   59 KKTLNERKRKYGVSVNKTVQHIEWNVDHFLKVQHERRQELYKDYSHQFLTLVMMWNIDVDQIKKQAGKLSDILDEQQKLF 138
gi 81870358   74 NKVLQENREKFSRIMTSSFSAMEVKIKDVLKTQCEQRQKLCQDYSLQFTNLSRKLTSDAYKLKKQAETLSNMFMEQQKFI 153
gi 123889670  86 SKAMQTKRKRLEVLTKNSLKGSTQKLEQMWKTQQNQRQKLTQDHSQQVFSVLQQWESDVLKSEEQEEKLNNLFRQQLKLF 165
gi 82086686   84 SKAMQAKRKRLETFTKSSLKGSNQKLEQLWNTQYAQRQKLTQEYSQQVSSVLQQWEIDAQKSEDQEEKLNNLFRQQQKLF 163
gi 82275071   84 SKVMQSKRKRLESLTKNYMKGSQNKLEQLWNTYHGQRQKLTQQYSQQVSAALQQWEMEAQRSEEQEEKFNSVFKQQLKIL 163
gi 82084825   44 NKAMQVKQKHLECLTKNHMTGSQHKLEQLWSNYHGQRKKTTQQFSQRVSTAFQQWEAEAHRTEEQEEKLSNLFRQQQKVL 123
gi 123906259  85 SKALMAKRKRLETYTKASLKTSNQKIENVWKTQQDDRQKLSSEYSQQFGDLCQRWEADAQKAEEQDEKLTNMIRQQQKLF 164
gi 75076611   82 NKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKIL 161
gi 148689538 101 NKALLAKRKRIEMYTKASFKASNQKIEQIWKTQQEEIQKLNNEYSQQFMNVLQQWELDIQKFEEQGEKLSNLFRQQQKIF 180
gi 156390294  20 SNTLNAKRKRIQSFSQASLKASSRKFDEVWRKQQNERSAQYEEFSKQVLLVLGQWEADLQKTREAEEKLESMYKQQQKLF 99
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 130337    140 KLSKCSQSQTLEAIKDMHENYMEGLMNLETNNYNMLFDVDGELRKEMSVF 189
gi 81905946  228 QRTRFVQNQRIRTIKEIHEQFLQKLEDLESKNDDLLTRTQNELKDEINDL 277
gi 81868643  139 QQFQSIHMQKIEEFKELCDRHLKNLQAIKCCRRK---AIIEEARKLMDYL 185
gi 81870358  154 HETLTLQKNRMEEFKSLCEKYLEKLEVLRDSRGN---SIAEELRRLIATL 200
gi 123889670 166 QQARVVQKQKIKTINDLHEQFVKNIEEMEKSHEAFLQGTQMELRKEMALL 215
gi 82086686  164 QQARVVQSQKLKTIKELYEQFIKNMEEMEKSHETFLQGAQVELKKEMAVL 213
gi 82275071  164 QQARVVQNQKLKMVRELYEQFVKDMEEMEKSHDAFLQGAQQELKKEMAIL 213
gi 82084825  124 QQARVAQNQKLKVVRELYDQFVKNMEEMEKSQNEFLQAAQEELKREMATL 173
gi 123906259 165 HQARIVQNQRLKTIRQDNEQFLKNMSDLEKTHEN----AQNELKKEMALL 210
gi 75076611  162 QQSRIVQSQRLKTIRQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAML 211
gi 148689538 181 QQSRIVQSQRMKAIKQIHEQFIKSLEDVEKNNDNLFTGTQSELKKEMAML 230
gi 156390294 100 NQQRIVQTQRLKRVQQLHEDYGKSLKELRKTHEDQQSSVQEQLRKEISGL 149
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap