Conserved Protein Domain Family
OspE

?
pfam02471: OspE 
Borrelia outer surface protein E
This is a family of outer surface proteins (Osp) from the Borrelia spirochete. The family includes OspE, and OspEF-related proteins (Erp). These proteins are coded for on different circular plasmids in the Borrelia genome.
Statistics
?
PSSM-Id: 145551
View PSSM: pfam02471
Aligned: 8 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Dec-2011
Updated: 5-Jan-2012
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam02471 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75342899  62 FSEFTVNIKNkKDNNGDWSNLGTLVIRKEQDGVETGLNVIgtingqlrGHSATFFCIEEAEVNNFVKAMTNVGSFKTSLY 141
gi 75344486  54 FSKFTVKIKN-KDNNSNWTDLGTLVVRKEENGIDTGLNAG--------GHSATFFSLKESEVNNFVKAMTEGGSFKTDEY 124
gi 75368271  41 FSEFTVKIKN-KNNSNNWADLGDLVVRKEEDGIETGLNVGkgdsdtfaGYTATFFSLEESEVNNFIKAMTEGGSFKTSLY 119
gi 75342894  44 FSEFTVKIKN-KDNSSNWSDLGTLVIRKEEDGIEIGLNAGi-------GHTSTFFSLEESEVNNFVKAMTEGGAFKTSLY 115
gi 75345386  38 FSEFTVKIKN-K-NSSNWENLGDLVVRKEEDGIATGLNAG--------GHSATFFCVEESEVNNFVKAMTEGGSFKASLY 107
gi 75345384  58 FSKFTVKIKN-KDNNSNWTDLGTLVVEKVEDGIVTGLNNDkq----ggGHSSTFFSLKESEVNNFIKAMTKGGSFKSSLY 132
gi 81552554 127 FFDFNVYIKYkKTNIGNWIDLGTLDLIKEEYSIVTDLNVG--------GHTARLFSVKESEINNFVNSMIRGGAFNAD-Y 197
gi 75342897  50 FSEFTVKIKYkKDNGGDWSDLGTLVVRKEEDGIETGLNVIvpfdgqviGYTSSFLYIEESEVNNFVKAMTKGGSFKTSLY 129
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 75342899 142 YGYKEEQSST-NGIKGKEITTKIETINNSEHITFSGD 177
gi 75344486 125 YGYGKEQSNLdNGTSNKEIITKIEKIDGTKYITFSGN 161
gi 75368271 120 YGYKDEQSNA-NGIQNKEIRTKIEKIGESEYITFLGD 155
gi 75342894 116 YGYNNEQSDA-NGIKNKEIITKIEKINDSEHITFSGD 151
gi 75345386 108 YGYKEEQSVA-NGIQNKEIITKIENINGVEHVAFLGD 143
gi 75345384 133 YGYKDEQSSA-NGIQNKEIITKIESINGAEHIAFLGD 168
gi 81552554 198 YGYQEG-----EDYKIKNIETKIETINDSQFITFLGR 229
gi 75342897 130 YGYKTEQNNV-NGIKNKEIKTKIETINGSEYITFAGD 165
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap