NCBI CDD Logo
?
pfam01021: TYA 
TYA transposon protein
Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.
Statistics
?
PSSM-Id: 144563
View PSSM: pfam01021
Aligned: 4 rows
Threshold Bit Score: 173.699
Threshold Setting Gi: 2497234
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:

pfam01021 is a member of the superfamily cl03073.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2497234    17 ACASVTSKEVQTTQDPLDISASKTEECEKVSTQANSQQPTTPLSSAVPENHHHASPQAAQVPLPQNGPYPQQRMMNTQQA 96
gi 74622305   17 ACASVTSKEVHTNQDPLDVSASKFDEYENNSTKASSQPEETPVSSAVPENAHHASPHTAQAPLPQNGPYSQQCMMTPNQA 96
gi 7839194    17 ACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENPHHASPQTAQSHSPQNGPYQQQCMMTQNQA 96
gi 2120070    57 AYASVTSKEVPSNQDPLAVSASNLPEFDRDSTKVNSQQETTPGTSAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKA 136
                         90
                 ....*....|....*...
gi 2497234    97 NISGWPVYGHPSLMPYPP 114
gi 74622305   97 NPSGWSVYGHPYMMPYTP 114
gi 7839194    97 NPSGWSFYGRPSMIPYTP 114
gi 2120070   137 MASNWAHYQQPSMMTCSH 154
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap