Conserved Protein Domain Family
HN_L-whirlin_R2_like

?
cd07357: HN_L-whirlin_R2_like 
Second harmonin_N_like domain (repeat 2) of the long isoform of whirlin, and related domains.
This subgroup contains the second of two harmonin_N_like domains found in the long isoform of whirlin, and related domains. Whirlin is a postsynaptic density-95/discs-large/ZO-1 (PDZ) domain-containing scaffold protein which binds various components of the Usher protein network of the inner ear and the retina: erythrocyte protein p55, usherin, VlGR1, and myosin XVa. The long isoform of whirlin contains two harmonin_N_like domains, and three PDZ protein-binding domains, PDZ1-3. The short whirlin isoform, derived from an alternative start ATG, lacks the first harmonin_N_like domain but has in common with the long isoform, this second harmonin_N_like domain (designated repeat 2, included in this subgroup) and PDZ3. This second harmonin_N_like domain is a putative protein-binding module based on its sequence similarity to the harmonin N-domain.
Statistics
?
PSSM-Id: 143618
View PSSM: cd07357
Aligned: 12 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 10-Apr-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Hierarchy
?
Display:
 
putative
Feature 1:putative protein binding pocket
Evidence:
  • Comment:based on the binding of the N-terminal domain of harmonin to an internal peptide of cadherin 23.

cd07357 is part of a hierarchy of related CD models.
Use the graphical representation to navigate this hierarchy.
cd07347:harmonin_N_likecd07353:harmonin_Ncd07354:HN_L-delphilin-R1_likecd07355:HN_L-delphilin-R2_likecd07356:HN_L-whirlin_R1_likecd07357:HN_L-whirlin_R2_likecd07358:HN_PDZD7_like19357996818923563922133114615654364211809921056404975119607826472062611157347781228909041563933821984244601935799681892356392213311461565436421180992105640497511960782647206261115734778122890904156393382198424460
cd07357 Sequence Cluster
cd07357 Sequence Cluster
Sub-family Hierarchy
Click to see CD Hierarchy help
 cd07357 Branch
 Whole Hierarchy
 [Download CDTree]
CD Hierarchy
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         ## ##  ##           ##  #  ## ##  #                            ####             
gi 118099210  144 VNQTRVMLEEQARHLLNEQERATMGYYLDEYKEGHISVDALVMALFELLNTHAKFSLLSEVRGVISPQDLDRFDNLVLKR 223
gi 56404975   419 GNQTRVLLEEQARHLLNEQEHATMAYYLDEYRGGSVSVEALVMALFKLLNTHAKFSLLSEVRGTISPQDLERFDHLVLRR 498
gi 119607826   68 GNQTRVLLEEQARHLLNEQEHATMAYYLDEYRGGSVSVEALVMALFKLLNTHAKFSLLSEVRGTISPQDLERFDHLVLRR 147
gi 47206261    18 VNQSRAILEEQARHLLTEGERQTMGYYLDQYRDGHVGVEQLVIALFELFNTHAKFSLLSEVRGLVSPQDLEHFDALVLRR 97
gi 156393382  397 GPSTKNLTTEQAKQVLNENELGTMTYYIREYTKGWISVDAFVLALFDLLSSPSKLSLLSEIRGVIAAKDIDRFDDLVLKK 476
gi 193579968  463 TSAASQMVEEKARILLTKNEFNTLRYYLDEYSCSRMSIDAFITILFELLNTTDKFTLLTELRELIGPSDRDRFDQLVYRR 542
gi 189235639  318 WAAALQMVEEKARCLLSRPEFTTLCYYTDEYASRHMTIDAFVQVMTELLNTPEKYTLMTELREIVAIEDRVRFDELVYRR 397
gi 221331146  573 KGQIATMVEEKARSLLPRHHFASLSYYIAEYSAKAMTIDAFVAVLLEMLDTYEKHTLVTEIRELVFPEDRTRYDELVYRR 652
gi 115734778  480 GVQNWSMLEDQSRNLLSENERGTMMYYLEEYQRNTITVEALVMALFELFDTHAKFSLLSEIRAFIFPRDIDRFDGLVLKR 559
gi 122890904  439 RAGAWSSLEEQAFMLLTETERQTMSYYIQEYQRAHIGVEPLAMALFELFNTHAKLSLLAEVRTLVAPQDLERFDGQVLLR 518
gi 198424460  513 SSLNNSLSCNPVWETLSEEEQKSLKYYVKEYLSSHVSPDALVLALSQLLADHEKFSLMSVIRDYISHRDLDRFDVLVLRR 592
gi 156543642  206 SAATAAMVEEKARVVLARSERAALSQLLADYRTRRLTVEDLVVSLGDLLNTHEKLTLLTELRELVDSKDRPAFDDLVYRR 285

                  .
Feature 1          
gi 118099210  224 E 224
gi 56404975   499 E 499
gi 119607826  148 E 148
gi 47206261    98 E 98
gi 156393382  477 E 477
gi 193579968  543 G 543
gi 189235639  398 D 398
gi 221331146  653 E 653
gi 115734778  560 E 560
gi 122890904  519 E 519
gi 198424460  593 E 593
gi 156543642  286 L 286

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap