Conserved Protein Domain Family
pheS_mito

?
TIGR00469: pheS_mito 
phenylalanyl-tRNA synthetase, mitochondrial
Unlike all other known phenylalanyl-tRNA synthetases, the mitochondrial form demonstrated from yeast is monomeric. It is similar to but longer than the alpha subunit (PheS) of the alpha 2 beta 2 form found in Bacteria, Archaea, and eukaryotes, and shares the characteristic motifs of class II aminoacyl-tRNA ligases. This model models the experimental example from Saccharomyces cerevisiae (designated MSF1) and its orthologs from other eukaryotic species. [Protein synthesis, tRNA aminoacylation]
Statistics
?
PSSM-Id: 129561
View PSSM: TIGR00469
Aligned: 2 rows
Threshold Bit Score: 804.294
Threshold Setting Gi: 5656618
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

TIGR00469 is classified as a model that may span more than one domain.
TIGR00469 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114152885  18 STLKVPHVEINGIKYKTDPQTtNVTDSIIKLTDRSLHLKESHPVGILRDLIEKKLNSVDN------TFKIFNNFKPVVTT 91
gi 5656618    29 SPSSPPQLEVSGSTYATDGWT-NVTPKILSYVGANKHLQTDHPLSIIRQRIVNYFYGAYRnqrgnpLFSVYDQMNPVVTV 107
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114152885  92 MENFDSLGFPKDHPGRSKSDTYYINETHLLRTHTSAHELECFQKIRNDsdniksgFLISADVYRRDEIDKTHYPVFHQME 171
gi 5656618   108 QQNFDNLLIPADHVSRQKSDCYYINQQHLLRAHTTAHQVELISGGLDN-------FLVVGEVYRRDEIDSTHYPVFHQAD 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114152885 172 gaTIWKRTKADVGVKEPMyIEKIREDIRQVENLLnkenvKITVDDDTIPLKENNPkqeyMSDLEVDLCSQHLKRSIELIV 251
gi 5656618   181 --AVRLVTKDKLFERNPG-LELFEETWSGTLADP-----KLILPHPSSWTKPNSP----ATRRAVKLMEHEMKHVLVGLT 248
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114152885 252 SEVFNKKIssmiknkanntpkelKVRWINAYFPWTAPSWEIEVWWQGEWLELCGCGLIRQDVLLRAGYKPSetIGWAFGL 331
gi 5656618   249 KDLFGPRI---------------KYRWVDTYFPFTQPSWELEIYFKDNWLEVLGCGIMRHEILQRSGVHQS--IGYAFGV 311
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114152885 332 GLDRIAMLLFEIPDIRLLWSRDERFSRQFSKG---LITSFKPYSKHPGSFRDVAFWLPEDKPDIHQVHENDLMEIIRNIA 408
gi 5656618   312 GLERLAMVLFDIPDIRLFWSNDSGFLSQFSEKdlhNLPKYKPISHYPQCTNDLSFWLPQDIEVDAGFSPNDFYDLVRSVA 391
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 114152885 409 GDLVESVKLVDSFTHPKTGRKSMCYRINYQSMDRNLTNAEVNTLQDMVCSKLVKEYSVEL 468
gi 5656618   392 GDMVEQISLVDKFKHPKTGKSSVCFRIVYRHMERTLTQAEVNEIHKQIASASVDSFNVQI 451
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap