Conserved Protein Domain Family
IL2

?
Interleukin-2 family
Interleukin-2 is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. This protein is required for T-cell proliferation and other activities crucial to the regulation of the immune response.
Links
?
Statistics
?
PSSM-Id: 128486
View PSSM: smart00189
Aligned: 4 rows
Threshold Bit Score: 175.448
Threshold Setting Gi: 290491146
Created: 13-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

smart00189 is a member of the superfamily cl23048.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7110653     1 MYSMQLASCVTLTLVLLVNSAPTSSSTSSSTaeaqqqqqqqqqqqQHLEQLLMDLQELLSRMENYRNLKLPRMLTFKFYL 80
gi 112807219   1 MYKIQLLSCIALTLILVTNSAPASSSTKETQ--------------QQLEQLLLDLRLLLNGVNNPENPKLSRMLTFKFYV 66
gi 21264448    1 MYKIQLLSCIALTLALVANGAPTSSSTGNTM--------------KEVKSLLLDLQLLLEKVKNPENLKLSRMHTFNFYM 66
gi 290491146   1 MYKTLLLSCLALTLALLTSSAPTSSSPKQTQ--------------DRLELLLRDLQTLLEGVTS--NPRLPKMLKLKLYP 64
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7110653    81 PKQ-ATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAF 159
gi 112807219  67 PKK-ATELTHLQCLVEELKPLEEVLYLAQSKNFHLNHIKELMSNINVTVLKLKGSETRFTCNYDDETATIVEFLNKWITF 145
gi 21264448   67 PKVnATELKHLKCLLEELKLLEEVLDLAPSKNLNTREIKDSMDNIKRIVLELQGSETRFTCEYDDATVKAVEFLNKWITF 146
gi 290491146  65 PKM-VSELQHLQCLEEELRAVEQVLNLAEHKNFPLIHTKDFISNINVTVLSLKGSETAFVCDLEDESVNIVEFLKRWTAF 143

                 ....*....
gi 7110653   160 CQSIISTSP 168
gi 112807219 146 CQSIFSTLT 154
gi 21264448  147 CQSIYSTMT 155
gi 290491146 144 CQKIMSRLT 152
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap