NCBI CDD Logo
?
Click on image for an interactive view with Cn3D
Early Protein (E6)
Statistics
?
PSSM-Id: 109569
View PSSM: pfam00518
Aligned: 26 rows
Threshold Bit Score: 117.381
Threshold Setting Gi: 267297
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
pfam00518 is a member of the superfamily cl19404.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3PY7_A       403 CLWCREPLTEVDAFRCMVKDFHVVIREG-CRYGACTICLENCLATERRLWQGVPVTGEEAELLHGKTLDRLCIRCCYCGG 481
gi 549260     27 CRFCQRFLTYIELVSLNRKGLQLIWTEEdFVFACCSSCAFATAQFEFSNFYEQSVCSWEIEIVEQKPVGDIIIRCKFCLK 106
gi 137781     11 CVFCYCVLGKVEARRCYDKKIRTVVRGG-LRCAVCTACLEKGLYLERVLNAPQPVYQGSIEEPD-PFIQKACIRCMYCGG 88
gi 586225     27 CIFCSHTVDLADLALFYLKKLSLVFRGN-CYYACCSECLRLSALFEQENYFQCSIKAVHLEEIAQKKIKEICIRCICCLR 105
gi 267297     37 CHFCSSFMDLNNKASYLASQLKVIVKDC-CFKGACIKCRRKLAFAERQKYQVCVGEADLVEAMVGSHVINLTVRCSECLA 115
gi 1352843    41 CNFCGNFLNYLEACEFDYKRLSLIWKDY-CVFACCRVCCGATATYEFNQFYEQTVLGRDIELASGLSIFDIDIRCQTCLA 119
gi 549270     25 CNFCTGFLTYQELLEFDYKDFNLLWKDG-FVFGCCAACAYRSAYHEFTNYHQEIVVGIEIEGRAAANIAEIVVRCLICLK 103
gi 549257     34 CKFCNRFLSYFELLNFDHKCLQLIWTEEdLVYGLCSSCAYASAQLEFTHFFQFAVVGKDIETVEGTAIGNICIRCRYCFK 113
gi 363548489  23 CTFCSRFLTQEELTAFDFSAFNLVWRGR-CAHGICTACARVCASLDLFLHHQNSRPLADVLRDENLTLHGLKARCRVCMK 101
gi 137759     26 CNFCNYFLSNAEKLLFDHFDLHLVWRDN-LVFGCCQGCARTVSLLEFVLYYQESYEVPEIEEILDRPLLQIELRCVTCIK 104
                         90       100       110
                 ....*....|....*....|....*....|..
3PY7_A       482 KLTKNEKHRHVLFNEPFCKTRaNIIRGRCYDC 513
gi 549260    107 KLDLIEKLDICYKEEQFHKVR-RNWKGLCRHC 137
gi 137781     89 ILTRDEKDRHRYFEELYVIFR-NQVLGRCYTC 119
gi 586225    106 LLDIVEKLDLLYSDETCYLIR-GLWRGYCRNC 136
gi 267297    116 LLTASEKLDAKCELQTFILVR-HMWRTSCRAC 146
gi 1352843   120 FLDIIEKLDCCGRGLPFHKVR-NAWKGICRQC 150
gi 549270    104 RLDLLEKLDICAQHREFHRVR-NRWKGVCRHC 134
gi 549257    114 LLDLVEKLATCYKFEQFYKVR-NSWKGLCRHC 144
gi 363548489 102 ILSVTEKLECAERGESFAKVR-GQWRARCRIC 132
gi 137759    105 KLSVAEKLEVVSNGERVHRVR-NRLKAKCSLC 135
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D