NCBI CDD Logo
?
COG0323: MutL 
DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 223400
View PSSM: COG0323
Aligned: 49 rows
Threshold Bit Score: 392.087
Threshold Setting Gi: 6323063
Created: 7-Oct-2002
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
COG0323 is classified as a model that may span more than one domain.
COG0323 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

gi 1346737   27 .[8].IHQINDIDVHRITSGQVITDLTTAVKELVDNSIDANANQIEIIFKDYGLE.[4].SDNGDGIDPSNYEFLALKHY 108
gi 19173567   1 .[2].IKRLPSDVISRISAGEVITRPYNILKETIENSLDANSTHITIKMEQDGLT.[3].EDDGDGIHESDFELLCKQYC 75
gi 19074926   1 .[1].IRKLPEDVGKRIRAQRSVQSIYIVVKELIENAIDSGCTWIRILVDDAITV     EDNGCGISDLDKVGVEGATS 71
gi 1709684    1 .[3].VKPIDANTVHKICSGQVITDVASAVKELVENSLDSGATTIEIRFKNYGIN.[4].VDNGSGIDAGDYESIGKKHF 77
gi 19112991   1 .[8].IRPLDQLVINKIAAGEIIERPENAIKELIENSLDAGSTSIDVLLKDGGLK.[4].TDNGSGIQYDDLPYLCQRFS 82
gi 15639295  29 .[8].IHRLSPDTAKKIAAGEVIERPASVVRELLENALDAGATKIHLEINAGGCA.[4].SDNGHGMSPQDLLLCAEAHT 110
gi 1709056    1 .[4].IKALDASVVNKIAAGEIIISPVNALKEMMENSIDANATMIDILVKEGGIK.[4].TDNGSGINKADLPILCERFT 78
gi 6325093    1 .[4].IRKLDSDVSERLKSQACTVSLASAVREIVQNSVDAHATTIDVMIDLPNLS.[3].YDDGIGLTRSDLNILATQNY 77
gi 20455095   1 .[4].IQALPQEVVYLITAGEVIDSFAAVVRELVENSLDAGANRIVVYLWPQQWR.[3].ADNGCGMNLDDLQQAASAHS 77
gi 16329972   5 .[4].IQVLDRQLVDLIAAGEVIDSPLAVVRELVENALDAGADRILVRVWWDQWR.[3].LDNGQGMDVTELKTSVLPHA 81

gi 1346737  109 TSKIAKFQD     VAKVQTLGFRGEALSSLCGIAKLSVITT.[2].PPKADKLEYDMVGHITS.[2].TTSRNK 172
gi 19173567  76 TSKLTKEEE     LFSLSSYGFRGEALSSISRCARIKVRSK.[1].REGEIGYEAVYRDTEMI.[3].GVGMKD 139
gi 19074926  72 KESMAYYVL.[4].RVEKFSYGFRGQALSCLAEVCDLEIISR     SEHSFALRKDFSTNAIS     KCARER 135
gi 1709684   78 TSKITDFED     LEALQTFGFRGEALSSLCAVGQVIISTA.[2].NEAPKGVQLNLDHEGSL.[4].TIPFQR 143
gi 19112991  83 TSKIDNFND     LQHLQTFGFRGEALASISHVAKVTVVTK.[2].SDIHAWKAFYVDGALAP.[5].SPAPQP 149
gi 15639295 111 TSKISSADD     LLQLRTLGFRGEALASIAAVSRLHLTST.[2].GPLAWHYQPKAAGTAAH.[4].PQGTEA 176
gi 1709056   79 TSKLQKFED     LSQIQTYGFRGEALASISHVARVTVTTK.[2].EDRCAWRVSYAEGKMLE.[2].KPVAGK 142
gi 6325093   78 TSKIRKMND     LVTMKTYGYRGDALYSISNVSNLFVCSK.[2].DYNSAWMRKFPSKSVML.[5].LPIDPF 144
gi 20455095  78 TSKIRSSAD     LWKIHSLGFRGEALHSLTTLADVEIISR     APENVGWRVVYGDSGKA.[3].EATAIA 140
gi 16329972  82 TSKISTQAD     LQRIKTLGFRGEALHSLAQVARLTISSR.[2].ASPGCGWRITYSPQGSP.[3].EPVAIA 146

gi 1346737  173       GTTVLVSQLFHNLPVRQK.[1].FSKTFKRQFTKCLTVIQGYAIIN.[1].AIKFSVWNI.[9].LSTMRNSSM 242
gi 19173567 140       GTIVEIKNIFYNNKVREK     HFSKKREEIREMMWLVGMYSVFN.[1].RISFELFYG.[9].RVCVGEDGY 208
gi 19074926 136       GTTVHVRNLFKNCPLRRP.[1].ADSGLKRDLGKICSLIESYRCAN     KINFTLFHK     RKVLLSCGG 195
gi 1709684  144       GTSVMVNDLFCTLPVRRK.[1].LEKNYKREFSKAISLLQAYATIS.[1].NKRFMVYHQ.[6].LLQLSTNSN 210
gi 19112991 150 .[ 5].GTVITAEDLFYNVRSRKS     ALKNGSEEFRRIMILVQKYAIHN.[1].QVSFNCKKV.[6].LSLSSRLSK 220
gi 15639295 177 .[10].GTVVRVEQLFENFPARKR     FLGRQSAETTLCRSALIDVSLAH.[1].PVEFRFTVD.[6].LLSQQTRKD 252
gi 1709056  143 .[ 1].GTTILVEDLFFNIPSRLR     ALRSHNDEYSKILDVVGRYAIHS.[1].DIGFSCKKF.[6].LSVKPSYTV 209
gi 6325093  145 .[11].GTVVIVEDMLYNLPVRRR.[2].KEEPPFKTFNTIKADMLQILVMH.[1].MISLNVQYT.[6].TEVLFRSKN 223
gi 20455095 141 .[ 1].GTVVTVSNLFASCAARRQ     GLPTTAQQMKAVQATIQQIALCH.[1].QTTWQVWQN.[6].ISPAATAGQ 207
gi 16329972 147 .[ 1].GTRVEVRQLFANFPQRRQ     AFAKSQQFWRPMVTYLQQLALCH.[1].QVTWQLWQD.[6].LSPGPNPEA 213

gi 1346737  243 RKN.[6].AGGMRGLEEVDLVLD.[20].LDY.[3].VKGYISQN.[4].GRNSKDRQFIYVNKRPVEYS      TLLK 328
gi 19173567 209 SNE.[2].VKRKVGMLNELYKAD.[ 6].SDK.[1].YLVIFSTQ.[1].FCLRKGMLVLFVNGRLVVSQ      EMKE 271
gi 19074926 196 YET     VREYFESNYPSFAGK.[ 1].MEV.[3].QMDLFMLP     VCVKEPKQLMFSERRPISNR      RILN 252
gi 1709684  211 KDM.[3].IMNVFGTKVSSSLIP.[ 2].DGI     IEGYISRP.[4].TRASNERQMLFINRRLVNLP      KIAR 272
gi 19112991 221 ADK     IRHIYGPRVASHLRD.[10].VGF.[1].ANGFISNA.[1].FQDKKSNLILFINNRLVESV      ELRH 285
gi 15639295 253 RCL.[1].TQMLKGDPALFHTIE.[ 3].CSF.[1].FHLVLSEP.[2].CRRERRGIFTFVNGRRIFDY      GLVQ 312
gi 1709056  210 QDR     IRTVFNKSVASNLIT.[ 6].EDL.[1].LESVDGKV.[5].ISKKSISPIFFINNRLVTCD      LLRR 274
gi 6325093  224 ITE.[2].TKHQQMSQVLRNVFG.[ 8].KKV.[3].FNEYQIEG.[5].PVGLKDLQFIYINGRRYADS.[16].EKGM 310
gi 20455095 208 LIP.[6].RPSDLQEIKLEIPNP.[11].NAS.[1].LALVVGLP.[3].HRHRPDWVRVAINGRMIKLP      ELEQ 281
gi 16329972 214 ILL.[6].QAGQLGYTQQSLSLP.[ 7].TSA.[1].LSLTFGYP.[3].HRPRPDWLIIAINGRPVNVP      ELTQ 283

gi 1346737  329 CCNEVYKT.[1].N     NV.[2].PAVFLNLELPM.[3].DVNVTPDKRVILLHNERAVIDIFKTTLSDYYNRQELAL 394
gi 19173567 272 SLFKVYKD.[1].L.[1].PQ.[2].PLIYLELYVEK.[3].DVNVHPSKREVLFSNEESMTQRLCKCIAERLSKLDYEQ 338
gi 19074926 253 AVKSEFGL.[1].V.[1].GS     PTFVLVIKGYG     DVNVSADKSEVIFADEAGILNLLRSEIGRFFSSEMYLN 314
gi 1709684  273 VIQEVFKP     Y.[1].MA.[2].PFFAINLRITN.[3].DINVSPDKKSVFLSEEDSIIEFIKNSLQNLCESCGHAI 338
gi 19112991 286 ALEETYAK.[1].L.[1].KG.[2].YFVYLSLNMSP.[3].DVNVHPSKRIVHFLYDQEIATSICDKLGEILERTDTER 352
gi 15639295 313 ALVLGSEG.[1].F.[1].NG.[2].PVACLFLTVNS.[3].DFNIHPAKKEVHLQDYAHIRHTLSRSVAHFYRQCTIAH 379
gi 1709056  275 ALNSVYSN.[1].L.[1].KG.[2].PFIYLGIVIDP.[3].DVNVHPTKREVRFLSQDEIIEKIANQLHAELSAIDTSR 341
gi 6325093  311 SLLKTKSV.[1].K.[1].YR.[2].PVFILDVRCPQ.[3].DLLQDPAKKIVKPSHIRTIEPLIVKTIRSFLTFQGYLT 377
gi 20455095 282 TILAAFHR.[1].L.[1].RD.[2].PLCFVHLLISP.[3].NWNRNPAKTEIYLHDLSYWQEQVTQAINQALRISAANI 348
gi 16329972 284 TILAVFHR.[1].L.[1].RQ.[2].PLCFAHWQLPP.[3].DWHRHPAKTEIYLQDLPHWQGQLKTLLHQSLAILGNDA 350

gi 1346737  395 P.[11].QKRLKTEVFDDR.[14].RSESNQS.[48].LDEGNSSTP.[207].KMEVVGQFNLGFIIVT.[4].NKYDL 728
gi 19173567 339 K.[ 1].LKPLPKDSFQSP.[ 4].SDPTSQS.[ 1].AECLEKETT.[ 26].SLSYVGVKDRDTILVQ     HGSSL 420
gi 19074926 315 P.[ 8].SNVQERSDAGED.[14].EDFPFLK.[ 6].PHREKAQQR.[ 83].RLEIIGQFNNGFIITK.[4].KKTYL 479
gi 1709684  339 S.[ 8].SYSSQIPDSSGD.[14].SETSDDS.[26].AEGASLAQV.[194].RMRVVGQFNRGFIVVV     HGNNL 630
gi 19112991 353 S.[11].NTKNAESSSQKA.[14].ERSIKSM.[ 5].LQRSSNNYD.[ 60].EHKYVGLVCPTRRIAA.[2].HNIGL 494
gi 15639295 380 Y.[ 2].AEPAHAPATQGN.[ 1].PTHSSPP.[ 5].EEPAAPCAH.[ 53].AFKVLGQVAGTFIAVE     RNNAL 490
gi 1709056  342 T.[11].ESLIPFNDTIES.[14].NSYTTAN.[20].AKITSFLSS.[113].LTDIFANLNYVGVVDE.[8].HDLKL 557
gi 6325093  378 P.[ 4].SSFEIVNCSQKT.[14].QVLNSKM.[ 9].GKPAVNGCR.[ 58].KYEVINQVDKKFILIR.[7].NCPLL 519
gi 20455095 349 P.[ 6].RVSQLLKAAEEK      GNYNFNP.[ 2].ANPADNTQN       YLKAVAQVSNTYIVAE     HPGGM 406
gi 16329972 351 P.[ 1].RLNQLLKAAEPK      GVYQLQG.[ 4].TETVLGYPK       AFKAIAQVCQTYVVVE     HDQGI 405

gi 1346737  729 FIVDQHASDEKYNFETLQAVTVF.[ 5].IIPQPVELS.[2].DELVVL.[8].NGFKLK.[2].E.[7].VKLLSLPTS 806
gi 19173567 421 LNCKTVPLLKEYLYQSLINDFGN      FEKKRTLVR     LRCKMD.[8].DYFSIE.[2].E.[3].VGIPIISTI 487
gi 19074926 480 VAVDQHAADEIRNFEDIKKTFCL.[ 5].ISPVKLDLT.[2].EEMVVS.[8].NGFVVK     D     GMLETVPVY 548
gi 1709684  631 FIIDQHASDEKFNYEHLKSNLVI.[ 5].VLPKRLDLA.[2].EETVLI.[8].KGFGVA.[2].L.[7].CTLLSVPTS 708
gi 19112991 495 YVVDYGKLSYHLFYQICLTEFGN.[10].SISDLFEIV.[4].DKSESE.[8].RRDMLK.[2].F.[7].GLLTAVPML 579
gi 15639295 491 YLIDQHAAHERIIFDTLQRNLGT.[ 4].LIPYHIHPR.[3].EARIMH.[8].AGFRFH.[2].P.[3].WHVTAVPLH 564
gi 1709056  558 FLIDYGSVCYELFYQIGLTDFAN.[ 9].NVSDDIVLY.[6].DELNDD.[8].KIWDMS.[2].L.[7].LVNDGLDND 643
gi 6325093  520 VLVDQHACDERIRLEELFYSLLT.[11].LKDCCIEVD.[2].EADLFK.[8].WGIGYE.[2].E.[7].LEIKTLPEM 603
gi 20455095 407 WLVEQHIAHERVLYEQLCDNWRL.[ 6].IILYQLSPA.[1].VAQLQR     IGLDID.[2].G.[3].WAVRNLPAM 472
gi 16329972 406 WLVEQHVAHERVLFEQLQRHWQC.[ 6].LVLQGFNPE.[1].VERLQN     LGLEID.[2].G.[3].WAVRSLPAL 471

gi 1346737  807 KQTLFD.[1].GDFNELIHLI.[15].IRSMFAMRACRSSIM     IGKPLNKKTMTRVVHNLSELD.[ 4].CPHGR 883
gi 19173567 488 CIDAPE.[1].WSGFEIRRSS.[ 1].YETLKNIIDVVSTLY     SGVEMSTKLFNILKRRIIGTA.[ 1].ALECF 547
gi 19074926 549 KNQTFG.[1].REFRELLEDV.[ 9].ARSIIASKACRTSVM     IGDVLSMADMKRIVKSLASLE.[ 4].CPHGR 619
gi 1709684  709 KNVIFD.[1].SDLLEIISVL.[12].LERMLASKACRSSVM     IGRALTISEMNTIVRHLAELS.[ 4].CPHGR 782
gi 19112991 580 SPKYHP.[1].FEQLPLLISS.[15].NGIMKAIAKFYVPLP.[4].ESDVKSIRSLESCLEDYLFPE.[10].VFEEK 666
gi 15639295 565 WRGSEE     QLAHDILYSG.[ 6].LRHVLATCACRSACK     DGTILDDATLHSLVEQAFALP.[ 3].CPHGR 630
gi 1709056  644 LKSVKL.[1].SLPLLLKGYI.[15].EVDWEDEQECLDGIL.[8].PDMVPKVDTSDASLSEDEKAQ.[ 4].KEHIS 728
gi 6325093  604 LTSKYN.[1].DKDYLKMVLL.[40].FHEILNSKACRSAVM     FGDELTRQECIILISKLSRCH.[ 4].CAHGR 705
gi 20455095 473 LQQRED.[1].AEAILELSWG.[ 2].LQTAQVAVACRSAIR     NGTPMSLPEMQKLLDDWQRTR.[ 4].CPHGR 536
gi 16329972 472 LQGQEE.[1].IAILRELSQV.[ 2].LSTAQAAIACRSAIK     NGMELDRIAINKLIEQWQQCD.[ 4].CPHGR 535

gi 1346737  884 .[2].MRHLMELR.[8]. 901
gi 19173567 548      GLVVTLKE.[8]. 563
gi 19074926 620 .[2].FMVLNEAE.[1]. 630
gi 1709684  783 .[2].MRHLLRLK.[2]. 794
gi 19112991 667 .[2].YQITSLPR.[8]. 684
gi 15639295 631 .[2].WIVIGRDE.[8]. 648
gi 1709056  729 .[2].LEHVLFPC.[8]. 746
gi 6325093  706 .[2].MVPIAELK      715
gi 20455095 537 .[2].YLSLDESS.[8]. 554
gi 16329972 536 .[2].YLALDESS.[8]. 553
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap