Conserved Protein Domain Family
AmyAc_bac2_AmyA

?
cd11316: AmyAc_bac2_AmyA 
Click on image for an interactive view with Cn3D
Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase)
AmyA (EC 3.2.1.1) catalyzes the hydrolysis of alpha-(1,4) glycosidic linkages of glycogen, starch, related polysaccharides, and some oligosaccharides. This group includes Chloroflexi, Dictyoglomi, and Fusobacteria. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
Links
?
Statistics
?
PSSM-Id: 200455
View PSSM: cd11316
Aligned: 53 rows
Threshold Bit Score: 464.748
Threshold Setting Gi: 291513576
Created: 18-Jul-2011
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
Hierarchy
?
Display:
 
Conserved site includes 18 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Structure:3K8L: Bacteroides thetaiotaomicron membrane associated alpha-amylase (SusG) binds maltoheptaose; contacts at 4A.
    View structure with Cn3D

cd11316 is part of a hierarchy of related CD models.
Use the graphical representation to navigate this hierarchy.
cd11316 is a member of the superfamily cl07893.
cd00551:AmyAc_familycd11313:AmyAc_arch_bac_AmyAcd11314:AmyAc_arch_bac_plant_AmyAcd11315:AmyAc_bac1_AmyAcd11316:AmyAc_bac2_AmyAcd11317:AmyAc_bac_euk_AmyAcd11318:AmyAc_bac_fung_AmyAcd11319:AmyAc_euk_AmyAcd11320:AmyAc_AmyMalt_CGTase_likecd11321:AmyAc_bac_euk_BEcd11322:AmyAc_Glg_BEcd11323:AmyAc_AGScd11324:AmyAc_Amylosucrasecd11325:AmyAc_GTHasecd11326:AmyAc_Glg_debranchcd11327:AmyAc_Glg_debranch_2cd11328:AmyAc_maltasecd11329:AmyAc_maltase-likecd11330:AmyAc_OligoGlucd11331:AmyAc_OligoGlu_likecd11332:AmyAc_OligoGlu_TScd11333:AmyAc_SI_OligoGlu_DGasecd11334:AmyAc_TreScd11335:AmyAc_MTase_Ncd11336:AmyAc_MTSasecd11337:AmyAc_CMD_likecd11338:AmyAc_CMDcd11339:AmyAc_bac_CMD_like_2cd11340:AmyAc_bac_CMD_like_3cd11341:AmyAc_Pullulanase_LD-likecd11343:AmyAc_Sucrose_phosphorylase-likecd11344:AmyAc_GlgE_likecd11345:AmyAc_SLC3A2cd11346:AmyAc_plant_IsoAcd11347:AmyAc_1cd11348:AmyAc_2cd11349:AmyAc_3cd11350:AmyAc_4cd11352:AmyAc_5cd11353:AmyAc_euk_bac_CMD_likecd11354:AmyAc_bac_CMD_likecd11355:AmyAc_Sucrose_phosphorylasecd11356:AmyAc_Sucrose_phosphorylase-like_1cd11359:AmyAc_SLC3A186160543310818566262197469297164853900202382211339941923602253298490613154979642621973203325243532248268901824126891638461093136760751923593491923602713150149793K8L A291513576339498730156736611608804762298265623026701422915345492931153402915569812915420193267920452278750882894508762209331522212184081638166353322973403354301321WZA A11381426931462954675701339426912408732584513111664032517948093044053483299275022975841803718342531367483925503618728403528086160543310818566262197469297164853900202382211339941923602253298490613154979642621973203325243532248268901824126891638461093136760751923593491923602713150149793K8L A291513576339498730156736611608804762298265623026701422915345492931153402915569812915420193267920452278750882894508762209331522212184081638166353322973403354301321WZA A113814269314629546757013394269124087325845131116640325179480930440534832992750229758418037183425313674839255036187284035280
cd11316 Sequence Cluster
cd11316 Sequence Cluster
Sub-family Hierarchy
Click to see CD Hierarchy help
 cd11316 Branch
 Whole Hierarchy
 [Download CDTree]
CD Hierarchy
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

Feature 1                                                                     # #                
1WZA_A         5 GTYYEIFVRSFYDSDGDGIGDLKGIIEKLDYLND.[8].LGVNGIWLMPIFKSPS     YHGYDVTDYYKINPDYGTLE 82
3K8L_A        38 DISYQLLLYSFADSDGDGYGDLNGVTQKLDYLNQ     LGVKALWLSPIHPCMS     YHGYDVTDYTKVNPQLGTES 107
gi 163846109  77 AVCYEIFVRSFYDSDGDGNGDLNGIIAKLDYLND.[8].LGINCIWLMPVAEAAS     YHGYDTIDYYTVERDYGTNE 154
gi 192359349  84 AVVYQIWPRSYYDTDGDGNGDLKGVTKKLDYLKA     LGITAIWLNPIFESNS     THGYDVIDYYQIEKDLGSMD 153
gi 192360271  51 AIFYEIWPRSFYDADGDGSGDFKGMTAKLDYLKD     LGVNGIWLTPIFEAPS     YHGYDFQDFYAVESDYGTMA 120
gi 224826890  57 SVFMEILVRAYQDSNGDGVGDLPGLIRRLDYLKS     LGVGALWLLPIYPSAD.[1].DHGYAVTNYRDVAPEFGSLA 127
gi 262197320  63 AVFMEIYVRGYKDSDGDGVGDFAGLTAQLDYLAE     LGIGGIWLMPMTESWD.[1].DHGYAVADYRAVESDYGTLA 133
gi 315014979  49 AIFYQIWPRSFYDSDADGHGDFNGMTQKLPYLQE     LGVNALWLTPMFEAPS     YHGYDFTEFYQVENDYGSMA 118
gi 315497964  49 ATFMEIFVRSYQDSDGDGIGDFNGLTSRLDYLQS     LGVTGIWLMPIHPSAD.[1].DHGYAVSDYRAVNPAFGTMA 119
gi 329849061  67 GQFMEVFVRSYKDSDGDGIGDLKGLTSKLDYLQS     LGVTGLWLMPVFESQD.[1].DHGYAVSDYRAIERDYGTLA 137

Feature 1                               #                                                        
1WZA_A        83 DFHKLVEAAHQRGIKVIIDLPINHTSERHPWFLKASRD.[1].NSEYRDYYVWAG.[10].DGGRVWHYSP       TG 155
3K8L_A       108 DFDRLVTEAHNRGIKIYLDYVMNHTGTAHPWFTEASSS.[1].ESPYRNYYSFSE.[21].YNAAEWFQVS.[125].IT 316
gi 163846109 155 DFKRLVAEAERRGIKIIIDLVLNHTSTQHPWFQEALRD.[1].NSPYRDWYLWSA.[ 9].GNNVVWHKSP.[  2].DE 228
gi 192359349 154 DFEELITAAKTSGIKVILDLALNHVSNDHPWFIKSANK     EPGYEDFFVWSE.[14].DPQAVWHYVA.[ 11].KD 240
gi 192360271 121 DFEEFVRESHARGIKVILDLVLNHISDKHEWFIKSANK     VPGYEDYFIWRD.[14].RPEAVWHWSE.[  2].KA 198
gi 224826890 128 DLDRLVQEAHRRGIAVILDYVINHSADSLPLFEAAKAD.[1].ASPWRDWYVWSA.[ 8].YGGDPWHAGA       GG 198
gi 262197320 134 EFETFVAEAHARGIGVIVDYVINHSAKDNPLFRDSWRD     LGGKRDWYVWRE.[ 8].GGDPSWHRIA       GA 203
gi 315014979 119 EFEAFIKAADDKGMKVILDLVINHISSNHEWFQRSAKQ     EAPYADYFIWRD.[17].QPDVVWHWNE.[  2].QQ 199
gi 315497964 120 DFERFVAEAHKRGIGVIIDYVMNHSANDNPIFLSAAKG.[1].TSPYRDWYLFAD.[ 7].FSWGPWRQNK.[  2].RG 191
gi 329849061 138 DFDDLITQAHARGIGVVLDYVMNHSAAQNPLFLDAVSS.[1].TNARRNWYVFNA.[ 7].WGGNPWRPTA       YG 207

Feature 1             #        #                                      # ## ##                    
1WZA_A       156 MYYGYF     WSGMPDLNYN.[1].PEVQEKVIGIAKYW     LKQGVDGFRLDGAMHIFP.[2].QYDKNFTWWEKF 218
3K8L_A       317 YFHSHF.[1].TDWFADLNYG.[7].SPAYQAIADAAKGW     IARGVDGLRLDAVKHIYH.[2].TSEENPRFLKMF 386
gi 163846109 229 YYYGVF     WGGMPDLNYR.[1].PAVTAEAYKIARFW.[1].EEMGVAGFRLDAIKHLIE.[6].DTVETFEWLREF 296
gi 192359349 241 WYYGAF     DPSQPDLNFK.[1].PAVIKEIEQLTKFW     IDKGVDGFRLDAIRYIIE.[8].DTAGTLNFWKHY 309
gi 192360271 199 YYYGAF     GSTQPDVNLT.[1].QAVVDELNNLAGFW     LEKGVDGFRLDAVRYAVE.[8].DTQSTMDYWTLF 267
gi 224826890 199 YYYAAF     SPQMPDFNFH.[1].PAVLEFHLNNLKFW     LNRGIDGFRFDAVGALVE.[7].NQPENLRIMASI 266
gi 262197320 204 FYYGVF     WDQMPDFNLR.[1].DEVLQYHADNLRFW     LNRGVDGFRFDAVGTLVE.[7].SQEENYAIMNQM 271
gi 315014979 200 YYYGAF     GASQPDLNLR.[1].PDVIAEMEKMAKFW     LDKGVAGFRLDAVRFAME.[7].DTDETIAYWQHF 267
gi 315497964 192 YFYGLF     DDQMPDFNLK.[1].QRVIDYHADNFRFW     LNKGVDGFRIDAVTMLVE.[7].DQPENIEVLKQV 259
gi 329849061 208 YNYGLF     ADSMPDFNLK.[1].PDVVAWHMDNLRFW     LNRGVDGFRFDAVETFVE.[7].NQPETHAVLVQA 275

Feature 1                        # #                           #                                 
1WZA_A       219 RQEIE.[ 4].VYLVGEVW.[3].ETVAPYF.[3].FDSTFNFKLAEAV.[10].GFNKKAKHIYG.[10].YIDAPFLT 300
3K8L_A       387 YEDMN.[11].FYMIGEVL.[3].DKVAPYY.[2].LPALFEFSFWYRL.[10].YFAKDILSYQQ.[ 8].YIEATKLS 472
gi 163846109 297 RRFLD.[ 5].TFTIGEVF.[4].RTLAPYY.[3].LDYYFEFEVANQI.[10].LFMQAVQDAYT.[ 4].QRWAPFLT 374
gi 192359349 310 STYVK.[ 5].IFLVGEAF.[3].AIAARYF.[5].LDAAFDFSFGLTV.[16].TLNQHYQRMRE.[16].YFFAKALN 406
gi 192360271 268 TQHVK.[ 5].AMLVAEAW.[3].KTVGRYR.[5].LDSAFDFDFGNVV.[27].NLWTNLQQRKA.[ 4].TYFSPFLT 363
gi 224826890 267 RALVE.[ 4].RYMVAEVP     GAPAEFA.[4].AGSAFAFGLQHEI      VKSAQLGRVQP.[11].ERMGTFLA 337
gi 262197320 272 RAVLG.[ 4].RFLICEEP.[4].RAAADDA     CGAAFGFGLNYDL.[ 7].ALREGVLDYLA.[ 3].NPMGIIQA 341
gi 315014979 268 NQYVK.[ 5].AYLVGEAW.[3].PVAAKYF.[5].LDQGFDFEVGYKI.[17].QSNQQVNTVDA.[17].DFFAPFLT 366
gi 315497964 260 NAVVK.[ 4].RYLICEAS     EQPALYA.[3].CTHSFAFGTQKEI.[11].KLATQLASDKR      SLMPLVLQ 329
gi 329849061 276 QTVIN.[ 4].RYMVCEAA     DHPSEYA.[5].CGNAFAFGKQWEV.[11].GLHAYLTASDR      AALPLFLS 347

Feature 1         ##                                                   ##   #                 
1WZA_A       301 NHDQNRILDQLG.[1].DRNKARVAASIYLTLPGNPFIYYGEEIGMRG.[1].GPHEVIREPFQWY.[ 5].GETYW 368
3K8L_A       473 NHNEDRTSSKLG.[1].SADKCKLAAAVLLTSAGHPYIYYGEELGLYG.[3].NGDEYVRSPMLWG.[ 2].YTTNY 539
gi 163846109 375 NHDQNRVMSVLG.[1].DVAKAKLAALALLTMPGLPFIYYGEEIGMLG.[1].KPDERIRTPMQWT.[ 5].GFSAG 442
gi 192359349 407 NHDIDRIHNHFS.[1].NHTLANIAAALLLTTPGTPFIYYGDEINMQQ.[3].GNDIYRRAPMQWN.[ 9].AKTTW 480
gi 192360271 364 NHDQNRIMHSLE.[1].NRVKAKIAASLLMTSPGTLYLYYGEEIGLSQ.[3].GDDQYRRAIMQWS.[15].DQSQW 443
gi 224826890 338 NHDSFAGARLAQ.[4].DEAANELAAATLLTLPGIPFLYYGEEIGQGP.[5].YEDQRLRGPMSWD.[ 4].GFSAG 411
gi 262197320 342 NHDAFAGDRLYA.[4].DEQVYKLAAAVQLSLPGIPFVYYGEEIGMGR.[4].SGDHALRAPMSWT.[ 4].GFTSG 414
gi 315014979 367 NHDQERVAYQLA.[1].HDDKAKLAAAMLFSSPGTPYIYYGEEIGLTQ.[3].GHDVYKRAPMQWD.[ 9].AQTSW 440
gi 315497964 330 SHDSYVGDRLIN.[2].NPGSYRVAAAVSVLASDTPFSYYGEEIGLAN.[3].YDDPGLRAPMSWD.[ 5].GFTTA 400
gi 329849061 348 NHDGFAGGRAID.[5].GEGDYRVAAAIALLASDTPFTYYGEEFGMGG.[3].SGDAGLRAPMSWT.[ 4].GFTSG 420

Feature 1                                              
1WZA_A       369 .[10].SVEQEEKNLDSLLNHYRRLIHFRNENPVFYTG 410
3K8L_A       540 .[13].TVADQQADTHSLLNIYFSLTRLRNTYPALAEG 584
gi 163846109 443 .[13].NVMLQDQDPESLLNTYRQLIHLHVNTPALATG 487
gi 192359349 481 .[35].TVAQQENNPDSTLMFYQRLIALRQNDAVLKLP 547
gi 192360271 444 .[23].SVEAQAADTESLYSHYKRLIHLRKQIPALQLP 498
gi 224826890 412 .[13].NVASEDGRADSLLNRYRALIRLRREQPALSIG 456
gi 262197320 415 .[13].NVADEREAPDSLLNHYKALIALRNQHESLALG 459
gi 315014979 441 .[28].NVKTQQAQSNSIWRLYQHLIALKKQRPELGIK 500
gi 315497964 401 .[14].NVKAQTGEGGSLLEYYRALYLARQTHPVLADG 446
gi 329849061 421 .[13].NAAAQAGVAGSLLETYRSLYAVRSSWPVLQSG 465

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap