Conserved Protein Domain Family
COX1

?
MTH00223: COX1 
cytochrome c oxidase subunit I; Provisional
Statistics
?
PSSM-Id: 177260
View PSSM: MTH00223
Aligned: 78 rows
Threshold Bit Score: 805.738
Threshold Setting Gi: 68989134
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
MTH00223 is a member of the superfamily cl00275.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

gi 84488575   21 .[4].WSTNHKDIGTLYLYSGVWGGLFGASLSLMIRMQLGHPGA.[1].FLKSDWFYNVVVTTHALMMIFFAVMPILIGA 95
gi 153123678   1      MANSHKDVGTMYLMLGMWSGFGGLNLSWMMRLELSRPGM     WLPSSEVYNGIVTLHAIMMIFFFVMPVLIGG 70
gi 68989134   31 .[4].MSTNHLDIGSFYMIFGFWAVLAGTSFSSLIRWSLYTPGA     KFLEPVVYNAVVTSHALVMIFFFVMPVMIGG 104
gi 7212457     1      MSTNHLDIGSFYMVFGFWAVLAGTSFSSLIRWSLYNPGA     KFLDPVTYNAVVTSHALVMIFFFVMPVMIGG 70
gi 229324832  30 .[4].MSTNHLDIGSFYMVFGFWAVLAGTSFSSLIRWSLYNPGA     KFLDPVTYNAVVTSHALVMIFFFVMPVMIGG 103
gi 229324852  30 .[4].MSTNHLDIGSFYMVFGFWAVLAGTSFSSLIRWSLYNPGA     KFLDPVTYNAVVTSHALVMIFFFVMPVMIGG 103
gi 229328221  30 .[4].MSTNHLDIGSFYMVFGFWAVLVGTSFSSLIRWSLYTPGA     KFLDPVTYNAVVTSHALVMIFFFVMPVMIGG 103
gi 254033633   1      MANSHKDVGTMYLMLGMWSGFGGLNLSWMMRLELSRPGM     WLPSSEVYNGIVTLHAIMMIFFFVMPVLIGG 70
gi 281190776  30 .[4].MSTNHLDIGSFYMVFGFWAVLAGTSFSSLIRWSLYNPGA     KFLDPVTYNAVVTSHALVMIFFFVMPVMIGG 103
gi 292496224  31 .[4].MSTNHLDIGSFYMVFGFWAVLAGTSFSSLIRWSLYNPGA     KFLDPVTYNAVVTSHALVMIFFFVMPVMIGG 104

gi 84488575   96 FGNWLIPLLVGGKDMIYPRMNNLSYWLSPNALYLLMLSFSTDKGVGAGWTIYPPLSV.[1].PYHSGPSMDVLIVSLHLA 171
gi 153123678  71 FGNWLLPMMLGAIDMSFPRLNTFSFWVLPPALYLVIVSCFIDYGSGTGWTMYPPLSS.[1].PYSGGMSTDLMILGLHLA 146
gi 68989134  105 FGNWLIPLMLEVADMQFPRLNAFSFWVLPGSLLLMLMSNMSESGVGSGWTIYPPLST     FSYHGVCMDFAILSLHLA 179
gi 7212457    71 FGNWLIPLMLLVADMQFPRLNAFSFWVLPGSLYLMLMSNIVENGVGAGWTIYPPLST     YSYHGVCMDLAILSLHLA 145
gi 229324832 104 FGNWLIPLMLQVADMQFPRLNAFSFWVLPGSLYLMLMSNIVENGVGAGWTIYPPLST     YSYHGVCMDLAILSLHLA 178
gi 229324852 104 FGNWLIPLMLQVADMQFPRLNAFSFWVLPGSLYLMLMSNIVESGVGAGWTIYPPLST     YSYHGVCMDLAILSLHLA 178
gi 229328221 104 FGNWLIPLMLQVADMQFPRLNAFSFWVLPGSLYLMLMSNLVESGVGAGWTIYPPLST     YSYHGVCMDLAILSLHLA 178
gi 254033633  71 FGNWLLPMMLGAIDMSFPRLNTFSFWVLPPALYLVIVSCFIDYGSGTGWTMYPPSSS.[1].PYSGGMSTDLMILGLHLA 146
gi 281190776 104 FGNWLIPLMLQVADMQFPRLNAFSFWVLPGSLYLMLMSNLVESGVGAGWTIYPPLST     YSYHGVCMDLAILSLHLA 178
gi 292496224 105 FGNWLIPLMLQVADMQFPRLNAFSFWVLPGSLYLMLMSNLVENGVGAGWTIYPPLST     YSYHGVCMDLAILSLHLA 179

gi 84488575  172 GLSSLVGAINFASTNKNMPVLEMKG.[2].AELYVLSISVTAVLLIISIPVLGGGITMILFDRNFNTTFFDPAGGGDPVL 248
gi 153123678 147 GISSSAASINYLVTFLNVRSKTFKA.[2].CPPFVWALSVTSFLLLVSLPVLAGGLTMLIMDRHFNCSFFDPSGGGDPVL 223
gi 68989134  180 GISSIFSSINFMVTISNMRSVGGHM     LALFPWSIKVTSFLLLTTLPVLAGGLTMLLTDRHFNTSFFDPVGGGDPVL 254
gi 7212457   146 GISSIFSSINFMVTISNMRSVGGHL     LALFPWSIKVTSFLLLTTLPVLAGGLTMLLTDRHFNTSFFDPVGGGDPVL 220
gi 229324832 179 GISSIFSSINFMVTISNMRSVGGHL     LALFPWSIKVTSFLLLTTLPVLAGGLTMLLTDRHFNTSFFDPVGGGDPVL 253
gi 229324852 179 GISSIFSSINFMVTISNMRSVGGHL     LALFPWSIKVTSFLLLTTLPVLAGGLTMLLTDRHFNTSFFDPVGGGDPVL 253
gi 229328221 179 GISSIFSSINFMVTISNMRSVGGHL     LALFPWSIKVTSFLLLTTLPVLAGGLTMLLTDRHFNTSFFDPVGGGDPVL 253
gi 254033633 147 GISSSAASINYLVTFLNVRSKTFKA.[2].CPPFVWALSVTSFLLLVSLPVLAGGLTMLIMDRHFNCSFFDPSGGGDPVL 223
gi 281190776 179 GISSIFSSINFMVTISNMRSVGGHL     LALFPWSIKVTSFLLLTTLPVLAGGLTMLLTDRHFNTSFFDPVGGGDPVL 253
gi 292496224 180 GISSIFSSINFMVTISNMRSVGGHL     LALFPWSIKVTSFLLLTTLPVLAGGLTMLLTDRHFNTSFFDPVGGGDPVL 254

gi 84488575  249 FQHLFWFFGHPEVYILILPAFGVMSKVIMHCSGKEAVFGLIGMVYAMIGIGGLGCMXWAHHMFTVGLNVDTRGYFSTATM 328
gi 153123678 224 FQHLFWFFGHPEVYVLILPGFGLVSHVLVFYTKKLRVFGSVAMMYAMISIGVLGFIVWGHHMYTVGLDVDTRFYFTAVTM 303
gi 68989134  255 FQHLFWFFGHPEVYVLILPGFGMISHVLCFWSSKKTAYGNMGMFYAMLNIGFLGFIVWGHHMFVAGMDIDTRAYFSAATV 334
gi 7212457   221 FQHLFWFFGHPEVYVLILPGFGMISHVLCFWSSKKTAYGNMGMFYAMLNIGFLGFIVWGHHMFVAGMDIDTRAYFSAATV 300
gi 229324832 254 FQHLFWFFGHPEVYVLILPGFGMISHVLCFWSSKKTAYGNMGMFYAMLNIGFLGFIVWGHHMFVAGMDIDTRAYFSAATV 333
gi 229324852 254 FQHLFWFFGHPEVYVLILPGFGMISHVLCFWSSKKTAYGNMGMFYAMLNIGFLGFIVWGHHMFVAGMDIDTRAYFSAATV 333
gi 229328221 254 FQHLFWFFGHPEVYVLILPGFGMISHVLCFWSSKKTAYGNMGMFYAMLNIGFLGFIVWGHHMFVAGMDIDTRAYFSAATV 333
gi 254033633 224 FQHLFWFFGHPEVYVLILPGFGLVSHVLVFYTKKLRVFGSVAMMYAMISIGVLGFIVWGHHMYTVGLDVDTRFYFTAVTM 303
gi 281190776 254 FQHLFWFFGHPEVYVLILPGFGMISHVLCFWSSKKTAYGNMGMFYAMLNIGFLGFIVWGHHMFVAGMDIDTRAYFSAATV 333
gi 292496224 255 FQHLFWFFGHPEVYVLIIPGFGMISHVLCFWSSKKTAYGNMGMFYAMLNIGFLGFIVWGHHMFVAGMDIDTRAYFSAATV 334

gi 84488575  329 VIAVPTGVKVFSWLATMAGSKFKMKPAAYWSTGFLFLFTVGGLTGVLLSSASMDVSLHDTYYVVAHFHYVLSMGAVFGVF 408
gi 153123678 304 LIAVPTGVKVFSWIATIYGSHLSFEAPVLWVLGFIVKFTMGGITGVILSNACLDVALHDTYYVVAHFHYVLSMGAVFTIF 383
gi 68989134  335 IIAVPTGIKVFAWISTMLGSKVSTQAPMLWATGFIVLFTIGGLTGLILSSASVDVTLHDTYFVTGHFHYVLSMGAVFTIL 414
gi 7212457   301 IIAVPTGIKVFAWISTMLGSKVSTQAPMLWSTGFIILFTTGGLTGLILSSASVDVTLHDTYFVTGHFHYVLSMGAVFTIL 380
gi 229324832 334 IIAVPTGIKVFAWISTMLGSKVSTQAPMLWSTGFIILFTTGGLTGLILSSASVDVTLHDTYFVTGHFHYVLSMGAVFTIL 413
gi 229324852 334 IIAVPTGIKVFAWISTMLGSKVSTQAPMLWSTGFIVLFTTGGLTGLILSSASVDVTLHDTYFVTGHFHYVLSMGAVFTIL 413
gi 229328221 334 IIAVPTGIKVFAWISTMLGSKVSTQAPMLWSTGFIVLFTIGGLTGLILSSASVDVTLHDTYFVTGHFHYVLSMGAVFTIL 413
gi 254033633 304 LIAVPTGVKVFSWIATIYGSHLSFEAPVLWVLGFIVKFTMGGITGVILSNACLDVALHDTYYVVAHFHYVLSMGAVFTIF 383
gi 281190776 334 IIAVPTGIKVFAWISTMLGSKVSTQAPMLWSTGFIVLFTTGGLTGLILSSASVDVTLHDTYFVTGHFHYVLSMGAVFTIL 413
gi 292496224 335 IIAVPTGIKVFAWISTMMGSKASTQAPMLWSTGFIILFTTGGLTGLILSSASVDVTLHDTYFVTGHFHYVLSMGAVFTIL 414

gi 84488575  409 CGLNHWLPNFVGVCFNKKWSKAHFMAMFFGVNTTFFPQHFLGLSGMPRRYMDYADIYAHWHWVSSYGSAVSFGSLMYFKF 488
gi 153123678 384 AGYVHYFPLFTGNCLHRSWARGHFFLTFVGVNLTFFPQHFLGLGGMPRRIPDYPIFYYYWNQWSTIGCAMVMVSVSLFIF 463
gi 68989134  415 AGFTHWFPLVAKVMMHRQKLKSHFLAMFLGVNLAFLPHHFLGLAGMPRRVVDYPDHFWFWNKVSTFGSHLSTASLLFFVF 494
gi 7212457   381 AGFTHWFPLVAKVMMHRQKMKSHFLAMFLGVNAAFLPHHFLGLAGMPRRVVDYPDHFWFWNKVSTFGSHLSTGSLLFFVF 460
gi 229324832 414 AGFTHWFPLVAKVMMHRQKMKSHFLAMFLGVNAAFLPHHFLGLAGMPRRVVDYPDHFWFWNKVSTFGSHLSTGSLLFFVF 493
gi 229324852 414 AGFTHWFPLVAKVMMHRQKMKSHFLAMFLGVNAAFLPHHFLGLAGMPRRVVDYPDHFWFWNKVSTFGSHLSTGSLLFFVF 493
gi 229328221 414 AGFTHWFPLVAKVMMHRQKLKSHFLAMFLGVNAAFLPHHFLGLAGMPRRVVDYPDHFWFWNKISTFGSHLSTGSLLFFVF 493
gi 254033633 384 AGYVHYFPLFTGNCLHRSWARGHFFLTFVGVNLTFFPQHFLGLGGMPRRIPDYPIFYYYWNQWSTIGCAMVMVSVSLFIF 463
gi 281190776 414 AGFTHWFPLVAKVMMHRQKLKSHFLAMFLGVNAAFLPHHFLGLAGMPRRVVDYPDHFWFWNKVSTFGSHLSTGSLLFFVF 493
gi 292496224 415 AGFTHWFPLVAKVMMHRQKMKSHFLAMFLGVNAAFLPHHFLGLAGMPRRVVDYPDHFWFWNKVSTFGSHLSTASLLFFVF 494

gi 84488575  489 LLWEALVSQRGVVFSGGLCGEMDW.[3].RDLYPGSKHVYSQLPFVWTNP 536
gi 153123678 464 MQWEAFFSGRRPLLVGNRPSSLEW.[3].RGFSCVARHTFTEVMALRIMH 511
gi 68989134  495 LLWESFIAQRPVVSVRNSSSSPEW     AVVASLPKHAGDELAKIIKLP 539
gi 7212457   461 LLWESFIAQRPVISVRNTSSSPEW     AVVSSLPKHAGDELAKMAKLC 505
gi 229324832 494 LLWESFIAQRPVISVRNTSSSPEW     AVVSSLPKHAGDELAKMAKLC 538
gi 229324852 494 LLWESFIAQRPVVSVRNTSSSPEW     AVVSSLPKHAGDELAKMAKLC 538
gi 229328221 494 LLWESFIAQRPVVSVRNTSSSPEW     AVVSSLPKHAGDELAKMAKLC 538
gi 254033633 464 MQWEAFFSGRRPLLVGNRPSSLEW.[3].RGFSCVARHTFTEVMALRIMH 511
gi 281190776 494 LLWESFIAQRPVVSVRNTSSSPEW     AVVSSLPKHAGDELAKMTKFC 538
gi 292496224 495 LLWESFIAQRPVISVRNTSNSPEW     SVVSSLPKHAGDELGKMAKLC 539
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap