NCBI CDD Logo
?
MTH00153: COX1 
cytochrome c oxidase subunit I; Provisional
Statistics
?
PSSM-Id: 177210
View PSSM: MTH00153
Aligned: 253 rows
Threshold Bit Score: 769.805
Threshold Setting Gi: 302632625
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
MTH00153 is a member of the superfamily cl00275.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

gi 49146479    1 .[1].KKWFFSTNHKDIGILYFIFGIWSGFIGASMSLLIRVELSVLGSYMNNDQMYNTLVTSHAFIMIFFMTMPLVIGGF 76
gi 5834927     1 .[1].MKWFMSTNHKNIGILYIILALWSGMLGSSMSLIIRMELSSPGSWISNDQIYNTIVTSHAFLMIFFMVMPFLIGGF 76
gi 27733918    1 .[1].NKWLMSTNHKNLGILYMIFALWSGMIGSSFSMLIRMELNSPGMWINNDQIYNSIVTSHAFLMLFFMVMPFLIGGF 76
gi 190349386   1 .[1].KKWLMSTNHKNIGMMYFIFAMWSGMIGSSTSLLIRMELSHPGMWINNDQIYNSLVTSHAFLMIFFMVMPFMIGGF 76
gi 221143402   1 .[1].KKWLMSTNHKNIGMMYFIFAMWSGMIGSSMSLLIRMELSHPGMWINNDQIYNSLVTSHAFLMIFFMVMPFMIGGF 76
gi 225012909   1      MRWLMSTNHKDIATLYFIFGVWSGMLGTSFSSLIRLELSQPGDFSMDFDYYNSVVTAHAFIMIFFMVMPIMMGGF 75
gi 256985337   1 .[1].GRWLMSTNHKDIATLYFVFGVWSGMLGTSFSSLIRLELSQPGDFSMDFDYYNSVVTAHAFIMIFFMVMPIMMGGF 76
gi 299827776   1 .[1].MKWLMSTNHKDIGMLYFMFGLWSGMLGFSMSLIIRLELGMPGSLIGNDQIYNSIVTSHAFIMIFFMVMPVMIGGF 76
gi 299890912   1 .[1].MKWFMSTNHKNIGILYILLALWSGMLGSSMSLIVRMELSSPGSWINNDQIYNTVVTSHAFLMIFFMVMPFLIGGF 76
gi 301353318   1      MKWMFSTNHKNIGTMYFMFSLFSGLMGTSFSMIIRMELMQPGSIIQNDFIYNSFITIHAMIMIFFMVMPAMIGGF 75

gi 49146479   77 GNWLVPLMVGAPDMAFPRMNNLSFWLLMPSLMFLILSMLVSGGGGTGWTVYPPLSTSMFHSGCSVDLMIFSLHLAGISSI 156
gi 5834927    77 GNWLIPLMLGSPDMAFPRMNNISFWLLPPSLFMLLLSNLFYPSPGTGWTVYPPLSAYLYHSSPSVDFAIFSLHMSGISSI 156
gi 27733918   77 GNYLVPLMLGSPDMAFPRMNNISFWLLPPSLMLLLLSNMFFPNSGTGWTVYPPLSLYLYHSSPSVDFTIFSIHMTGISSI 156
gi 190349386  77 GNYLIPLMLGSPDMAFPRMNNISFWLLPPSLFMLLLTNLFSPNVGTGWTIYPPLSSYLFHSSPSIDIAIFSLHMSGISSI 156
gi 221143402  77 GNYLIPLMLGSPDMAFPRMNNISFWLLPPSLFMLLLSNTFTPNVGTGWTIYPPLSSYLFHSSPSIDIAIFSLHMSGISSI 156
gi 225012909  76 GNLLVPLMIGATDMAYPRLNNMSFWLLPPSLSLLVSSAVVGSGVGTGWTVYPPLSNGIFHSGPAVDFGILSLHIAGVSSI 155
gi 256985337  77 GNLLVPLMIGATDMAYPRLNNMSFWLLPPSLSLLVSSAVVGSGVGTGWTVYPPLSNGIFHSGPAVDFGILSLHIAGVSSI 156
gi 299827776  77 GNWLIPLMLGSPDMSFPRMNNMSFWLLIPSLLLLILSSFINVGVGTGWTVYPPLSLILGHGGMSVDLGIFSLHLAGASSI 156
gi 299890912  77 GNWLIPLMLGSPDMAFPRMNNISFWLLPPSLFMLLLSNLFYPSPGTGWTVYPPLSAYLYHSSPSVDFAIFSLHMSGISSI 156
gi 301353318  76 GNWLIPLMINSMDLCFPRLNNMSFWMLIPSLILMLNSSLKGVLNGVGWTMYPPLTSIQYFMSSSIDMMIFSLHIAGLSSI 155

gi 49146479  157 LGSINFITTIINMRLIGMKLENMPLFVWSVLITVFLLLLSLPVLAGAITMLLMDRNFNSTFFDPMGGGDPILYQHLFWFF 236
gi 5834927   157 MGSLNLMVTIMMMKNFSMNYDQISLFPWSVFITAILLIMSLPVLAGAITMLLFDRNFNTSFFDPMGGGDPILYQHLFWFF 236
gi 27733918  157 LGSLNFIVTIFMMKNFSLNYDQINLFSWSISITVILLILSLPVLAGAITMLLFDRNFNTSFFDPMGGGDPILYQHLFWFF 236
gi 190349386 157 IGSLNFIVTILMMKNFSLNYDQINLFSWSVCITVILLILSLPVLAGAITMLLFDRNFNTSFFDPMRGGDPILYQHLFWFF 236
gi 221143402 157 IGSLNFIVTILMMKNFSLNYDQINLFSWSVCITVILLILSLPVLAGAITMLLFDRNFNTSFFDPMGGGDPILYQHLFWFF 236
gi 225012909 156 LGAINFIVTIFNMKVQGMGWSNVPLFVWSVFITSFLLAFSLPVLAAALTMLLTDRNFNSTFFDPVGGGDPILYQHLFWFF 235
gi 256985337 157 LGAINFIVTIINMKVEGMGWSSVPLFVWSVFITSFLLAFSLPVLAAALTMLLTDRNFNSTFFDPVGGGDPILYQHLFWFF 236
gi 299827776 157 MGAVNFITTIMNMRSNLFNMDKMSLFSWSVFITAILLLLSLPVLAGAITMLLTDRNMNTSFFDPSGGGDPILYQHLFWFF 236
gi 299890912 157 MGSLNLMVTIMMMKNFSLNYDQISLFPWSVFITAILLIMSLPVLAGAITMLLFDRNFNTSFFDPMGGGDPILYQHLFWFF 236
gi 301353318 156 ASSINFISTILLMKNKNFFFSMMTLFSMSILITTFLLLIALPVLAGGITMILMDRNFNTSFFDPSGGGDPILYQHLFWFF 235

gi 49146479  237 GHPEVYVLILPGFGIISHLISNESGKMEVFGSLGMIYAMLTIGILGFIVWGHHMFTVGMDVDTRAYFTSATMVIAIPTGI 316
gi 5834927   237 GHPEVYILILPGFGLISHIVMNESGKKEIFGNLSMIYAMLGIGFLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAVPTGI 316
gi 27733918  237 GHPEVYILILPGFGLISQIIMNESGKKEIFGNLSMIYAMLGIGFLGFIVWAHHMFTVGLDIDTRAYFTSATMIIAIPTGI 316
gi 190349386 237 GHPEVYILILPGFGLISQIIMNESGKKETFGNLSMIYAMLGIGFLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAVPTGI 316
gi 221143402 237 GHPEVYILILPGFGLISQIIMNESGKKETFGNLSMIYAMLGIGFLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAVPTGI 316
gi 225012909 236 GHPEVYILILPGFGIISHTVSFYSNKIEPFGSLGMIYAMISIATLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAVPTGV 315
gi 256985337 237 GHPEVYILILPGFGIISHTVSFYSNKVEPFGSLGMIYAMVSIAVLGFIVWAHHMFTVGLDIDTRAYFTSATMIIAVPTGV 316
gi 299827776 237 GHPEVYILILPGFGIISHMIFNESGKKETFGMLGMIYAMLTIGFLGFIVWAHHMFTIGMDVDTRAYFTSATMIIAIPTGI 316
gi 299890912 237 GHPEVYILILPGFGLISHIVMNESGKKEIFGNLGMIYAMLGIGFLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAVPTGI 316
gi 301353318 236 GHPEVYILILPGFGMISHVISYNLGKKEVFGKMGMMFAMMSIGLLGFVVWAHHMFTVGMDVDTRAYFTAATMIIAIPTGI 315

gi 49146479  317 KIFSWLATFSGINFK.[1].NNPLMLWSMGFLFLFTLGGLTGVILGNSSVDVCLHDTYFVVAHFHYVLSMGIVFAIISGF 392
gi 5834927   317 KVFSWLATYHGSKLK     LNISILWSLGFIMLFTIGGLTGIMLSNSSIDIILHDTYYVVGHFHYVLSMGAVFAIISSF 391
gi 27733918  317 KVFSWLATYHGSKLN     FNISFMWSIGFILMFTIGGLTGIMLSNSSIDIILHDSYYVVGHFHYVLSMGAVFSIIASF 391
gi 190349386 317 KVFSWLATYHGSKMN     FNITIIWSIGFILMFTIGGLTGVMLSNSSIDIILHDTYYVVGHFHYVLSMGAVFAIITSL 391
gi 221143402 317 KVFSWLATYHGSKMN     FNITIIWSIGFILMFTIGGLTGVMLSNSSIDIILHDTYYVVGHFHYVLSMGAVFAIISSI 391
gi 225012909 316 KVFSWLATMLGGKLD     FSPSFLWSMGFVFLFTVGGLTGVILSNSSLDVSLHDTYYVVAHFHYVLSMGAVFAIMAGI 390
gi 256985337 317 KVFSWLATMLGGKLD     FSPSFLWSMGFVFLFTVGGLTGVILSNSSLDVSLHDTYYVVAHFHYVLSMGAVFAIMAGI 391
gi 299827776 317 KIFSWMATFSGVKLI     NNLMILWTMGFIFLFTVGGLTGVVLSNSSVDVVLHDTYYVVAHFHYVLSMGAVFSILGGF 391
gi 299890912 317 KVFSWLATYHGSKLK     LNISVLWSLGFIMLFTIGGLTGIMLSNSSIDIILHDTYYVVGHFHYVLSMGAVFAIISSF 391
gi 301353318 316 KIFSWFTTMINSHIN     FNISIYWSMGFLIMFSIGGFTGIIASNSCLDIALHDTYYIVAHFHYVLSMGAVFAIFSGL 390

gi 49146479  393 IFWFPLIIGLTLNSNLLISQFYIMFIGINMTFFPQHFLGLNGMPRRYSDYFDCYLFWNKISSMGSLISFLGILYFLYIIL 472
gi 5834927   392 IHWYPLITGLLLNIKWLKIQFIMMFIGVNLTFFPQHFLGLMSMPRRYSDYPDSYYCWNSISSMGSMISLNSMIFLIFIIL 471
gi 27733918  392 IHWFPLISGLMMNQKWLKFQFFFMFIGVNLTFFPQHFLGLMGMPRRYSDYPDSYYCWNMISSLGSMISMNSLLFMMFIIF 471
gi 190349386 392 IHWYPMITGLLMNQKWLKIQFIMMFIGVNMTFSPQHFLGLMSMPRRYPDYPDSYYCWNLISSIGAMISMNSMLFLIFIIF 471
gi 221143402 392 IHWFPMITGLMMNQKWLKIQFIMMFIGVNMTFFPQHFLGLMSMPRRYSDYPDSYYCWNLISSIGAMISMNSMLLLIFIIF 471
gi 225012909 391 THWFPVMYNMPMNPYLLKGQFWVMFLGVNLTFFPQHFLGLNGMPRRYCDYPDGFTYWNTISSLGSFITVMSIVIFIFIMW 470
gi 256985337 392 THWFPAIYNIPMNPYFLKGQFWVMFLGVNLTFFPQHFLGLNGMPRRYCDYPDGFTYWNTVSSLGSLVTVMSIVFFVFIIW 471
gi 299827776 392 IYWFPMFFGLMMNEYFLKIHFYLTFIGVNLIFFPQHFLGLSGMPRRYSDYPDMYLNWNLFSSFGSLISLVGVFLFIFIIW 471
gi 299890912 392 IHWYPLITGLLLNVKWLKIQFIMMFIGVNLTFFPQHFLGLMSMPRRYSDYPDSYYCWNSISSLGSMISLNSIIFLIFIIL 471
gi 301353318 391 FMWFPLMYNFYMNMNFLKIHFWSSMIGINLTFFPQHFLGLMGMPRRYSDYLDSMYMWNFLSSLGSMITFISTVFFLYIML 470

gi 49146479  473 ESFIMIRLLNFKIF.[1].INFLEWMINYPSLDHSFKELGLIFK 512
gi 5834927   472 ESLISKRMLLFKFN     QSSLEWLNFLPPLDHSHLEIPLLIK 510
gi 27733918  472 ESLMSKRFILFKFH     QSSLEWLNNYPPFNHMCNEIPLLMK 510
gi 190349386 472 ESFISKRLILFKFH     QSSLEWLNNYPPFDHSLIEIPLISK 510
gi 221143402 472 ESLISKRLILFKFH     QSSLEWLNNYPPFDHFLMEIPLISK 510
gi 225012909 471 EGMSSGRVINYYSS.[1].LISSEFYYESPAPSHTNVEAWKVCS 510
gi 256985337 472 EGVSSGRVVNQYTS.[1].LTTSEFFYDSPSPSHTNVEAWKVFN 511
gi 299827776 472 ESLIMQRFVIFVKF.[1].NSSIEWFHLYPPLDHSYDETLKVSI 511
gi 299890912 472 ESLISKRMMLFKFN     QSSLEWLNFYPPLDHSHLEIPLLIK 510
gi 301353318 471 EMFLMNKMILMFES.[1].SNNMEFFFFSPLESHTMMNFNLIMF 510
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap