Conserved Protein Domain Family
COX1

?
MTH00077: COX1 
cytochrome c oxidase subunit I; Provisional
Statistics
?
PSSM-Id: 177147
View PSSM: MTH00077
Aligned: 53 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 9-Dec-2010
Updated: 15-Dec-2010
Structure
?
Aligned Rows:
MTH00077 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

gi 53686435    2 MITRWLFSTNHKDIGTLYLMFGAWAGMVGTALSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNW 81
gi 134303131   1 MFTRWFFSTNHKDIGTLYLIFGAWAGMVGTALSLLIRAELSQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPILIGGFGNW 80
gi 164519182   1 MITRWLFSTNHKDIGTLYLIFGAWAGMVGTALSLLIRAELSQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNW 80
gi 68989192    1 MLTRWLFSTNHKDIGTLYLIFGAWAGMIGTSLSLLIRAELAQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPILIGGFGNW 80
gi 47777255    1 MFTRWFFSTNHKDIGTLYLIFGAWAGMIGTALSLLIRAELAQPGSLLGDDQIYNVIVTAHAFVMIFFMVMPILIGGFGNW 80
gi 146149051   1 MITRWLFSTNHKDIGTLYLIFGAWAGMVGTALSLLIRAELSQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNW 80
gi 14389436    1 MFTRWFFSTNHKDIGTLYLIFGAWAGMVGTALSLLIRAELSQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPILIGGFGNW 80
gi 55583401    1 MITRWFFSTNHKDIGTLYLIFGAWAGMVGTALSLLIRAELSQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNW 80
gi 229324820   1 MPSRWLFSTNHKDIGTMYLIFGAWAGMIGTALSLLIRAELSQPGSLLGDDQIYNVIVTAHAFVMIFFMVMPILIGGFGNW 80
gi 33438947    1 MFSRWLFSTNHKDIGTMYLIFGAWAGMTGTALSLLIRAELSQPGALLGDDQIYNVVVTAHAFVMIFFMVMPILIGGFGNW 80

gi 53686435   82 LLPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASSGVEAGAGTGWTVYPPLAGNMAHAGASVDLTIFSLHLAGVSSILGA 161
gi 134303131  81 LVPLMIGAPDMAFPRMNNMSFWLLPPSFFLLLASSTVEAGAGTGWTVYPPLAGNLAHAGPSVDLAIFSLHLAGVSSILGA 160
gi 164519182  81 LVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSAVEAGAGTGWTVYPPLAGNLAHAGPSVDLTIFSLHLAGVSSILGA 160
gi 68989192   81 LVPLMIGAPDMAFPRMNNMSFWLLPPSFFLLLASSMVEAGVGTGWTVYPPLAGNIAHAGPSVDLAIFSLHLAGVSSILGA 160
gi 47777255   81 LVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSTVEAGAGTGWTVYPPLAGNLAHAGPSVDLAIFSLHLAGVSSILGA 160
gi 146149051  81 LVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSAVEAGAGTGWTVYPPLAGNLAHAGPSVDLTIFSLHLAGVSSILGA 160
gi 14389436   81 LVPLMIGAPDMAFPRMNNMSFWLLPPSFFLLLASSTVEAGAGTGWTVYPPLAGNLAHAGPSVDLAIFSLHLAGVSSILGA 160
gi 55583401   81 LVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSAVEAGAGTGWTVYPPLAGNLAHAGPSVDLTIFSLHLAGVSSILGA 160
gi 229324820  81 LVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSAVEAGAGTGWTVYPPLAGNLAHAGPSVDLAIFSLHLAGVSSILGA 160
gi 33438947   81 LIPLMIGAPDMAFPRMNNMSFWLLPPSFFLLLASSTVEAGAGTGWTVYPPLAGNLAHAGPSVDLAIFSLHLAGVSSILGA 160

gi 53686435  162 INFITTSINMKPPAMSQYQTPLFVWSVLITAILLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPVLYQHLFWFFGHP 241
gi 134303131 161 INFITTIINMKPTSITQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHP 240
gi 164519182 161 INFITTIINMKPPSVTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPVLYQHLFWFFGHP 240
gi 68989192  161 INFITTILNMKPASMTQYQTPLFIWSVLVTAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPVLYQHLFWFFGHP 240
gi 47777255  161 INFITTILNMKPSSTTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPVLYQHLFWFFGHP 240
gi 146149051 161 INFITTIINMKPPSVTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPVLYQHLFWFFGHP 240
gi 14389436  161 INFITTIINMKPTSITQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPVLYQHLFWFFGHP 240
gi 55583401  161 INFITTIINMKPPSVTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPVLYQHLFWFFGHP 240
gi 229324820 161 INFITTIINMKPPSTTQYHTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRIKTTSFFDPAGGGDPILYQHLFWFFGHP 240
gi 33438947  161 INFITTIINMKPPSTTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHP 240

gi 53686435  242 EVYILILPGFGMISHIVTYYSAKKEPFGYMGMVWAMMSIGLLGFIVWAHHMFTVDLNVDTRAYFTSATMIIAIPTGVKVF 321
gi 134303131 241 EVYILILPGFGIISHVVAYYSNKKEPFGYMGMVWAMLSIGLLGFIVWAHHMFTTDLNVDTRAYFTSATMIIAIPTGVKVF 320
gi 164519182 241 EVYILILPGFGIISHVVAYYSSKKEPFGYMGMVWAMMSIGLLGFIVWAHHMFTTDLNVDTRAYFTSATMIIAIPTGVKVF 320
gi 68989192  241 EVYILILPGFGIISHIVAYYSNKKEPFGYMGMVWAMLSIGLLGFIVWAHHMFTTDLNVDTRAYFTSATMIIAIPTGVKVF 320
gi 47777255  241 EVYILILPGFGIISHVVAYYSNKKEPFGYMGMVWAMLSIGLLGFIVWAHHMFTTDLNVDTRAYFTSATMIIAIPTGVKVF 320
gi 146149051 241 EVYILILPGFGIISHVVAYYSSKKEPFGYMGMVWAMMSIGLLGFIVWAHHMFTTDLNVDTRAYFTSATMIIAIPTGVKVF 320
gi 14389436  241 EVYILILPGFGIISHVVAYYSNKKEPFGYMGMVWAMLSIGLLGFIVWAHHMFTTDLNVDTRAYFTSATMIIAIPTGVKVF 320
gi 55583401  241 EVYILILPGFGIISHVVAYYSSKKEPFGYMGMVWAMMSIGLLGFIVWAHHMFTTDLNVDTRAYFTSATMIIAIPTGVKVF 320
gi 229324820 241 EVYILILPGFGIISHVVAYYSTKKEPFGYMGMVWAMLSIGLLGFIVWAHHMFTTDLNVDTRAYFTSATMIIAIPTGVKVF 320
gi 33438947  241 EVYILILPGFGIISHVVAYYSTKKEPFGYMGMVWAMLSIGLLGFIVWAHHMFTTDLNVDTRAYFTSATMIIAIPTGVKVF 320

gi 53686435  322 SWLATMHGGAIKWDAAMLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFS 401
gi 134303131 321 SWLATMHGGIIKWEAPMLWALGFIFLFTVGGLTGIVLANSSIDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFT 400
gi 164519182 321 SWLATMHGGIIKWEAPMLWALGFIFLFTVGGLTGIVLANSSIDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFT 400
gi 68989192  321 SWLATMHGGIIKWEAAMLWALGFIFLFTVGGLTGVVLANSSIDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFIHWFPLFT 400
gi 47777255  321 SWLATMHGGIIKWEAAMLWALGFIFLFTVGGLTGIVLANSSIDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFT 400
gi 146149051 321 SWLATMHGGIIKWEAPMLWALGFIFLFTVGGLTGIVLANSSIDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFT 400
gi 14389436  321 SWLATMHGGIIKWEAPMLWALGFIFLFTVGGLTGIVLANSSIDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFT 400
gi 55583401  321 SWLATMHGGIIKWEAPMLWALGFIFLFTVGGLTGIILANSSIDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFT 400
gi 229324820 321 SWLATMHGGIIKWEAPMLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFMHWFPLFT 400
gi 33438947  321 SWLATMYGGIIKWEAPMLWALGFIFLFTVGGLTGIVLANSSIDIVLHDTYYVGAHFHYVLSMGAVFAIMAGFVHWFPLFT 400

gi 53686435  402 GFTLHPTWSKIHFGVMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTVSSIGSLISLVAVIMMMFIIWEAFASKRE 481
gi 134303131 401 GYTLHELWTKIHFVVMFTGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTVSSVGSLISLVAVVMMMFIIWEAFAAKRL 480
gi 164519182 401 GYTLHDTWTKIHFGVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTISSIGSLISLVAVILMMFIIWEAFSAKRL 480
gi 68989192  401 GYTLHSTWTKIHFSIMFTGVNLTFFPQHFLGLAGMPRRYSDYPDAYALWNTVSSIGSLISLVAVVMMVFIVWEAFSAKRL 480
gi 47777255  401 GFSLHNTWTKVHFGVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYALWNTVSSIGSLISLVAVAMMVFIIWEAFAAKRL 480
gi 146149051 401 GYTLHHSWTKIHFGVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTVSSIGSLISLVAVVLMMFIIWEAFSAKRL 480
gi 14389436  401 GYTLHELWTKIHFVVMFTGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTVSSVGSLISLVAVVMMMFIIWEAFAAKRL 480
gi 55583401  401 GYTLHHSWTKIHFGVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTVSSIGSLISLVAVVLMMFIIWEAFSAKRL 480
gi 229324820 401 GFMFHKIWAKAQFAVMFTGVNVTFFPQHFLGLAGMPRRYSDYPDAYTLWNTVSSMGSLISLVGVIMLMFIIWEAFTSKRL 480
gi 33438947  401 GFTFHKTWAKAQFAVMFTGVNVTFFPQHFLGLAGMPRRYSDYPDAYALWNTISSMGSLISLVGVIMLMFIIWEAFSSKRL 480

gi 53686435  482 ILTTELNPTNIEWLYGCPPPYHTFEEPSYVQ.[2]. 514
gi 134303131 481 FSGSELTSTNIEWLLGFPPHYHTFEESLSLS.[1]. 512
gi 164519182 481 FSNAELTTTNVEWLLGFPPHYHTFEESTFSI.[2]. 513
gi 68989192  481 FVESQLTSTNVEWSLGFPPNHHTFEEASFSV.[2]. 513
gi 47777255  481 FTGAQLISTNIEWSLGYPPNYHTFEESAFSI.[2]. 513
gi 146149051 481 FSNAELTTTNVEWLLGFPPHYHTFEESTFSI.[2]. 513
gi 14389436  481 FSGSELTSTNIEWLLGFPPHYHTFEESLSPL.[1]. 512
gi 55583401  481 FSNAELTSTNVEWLLGFPPHYHTFEESTFSI.[2]. 513
gi 229324820 481 FTNPKLPSTNIEWLLGFPPQHHTFEAGFLLF      511
gi 33438947  481 FSNPKLTTTNIEWLLGFPPQHHTFEASFLLI      511
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap