NCBI CDD Logo
?
MTH00037: COX1 
cytochrome c oxidase subunit I; Provisional
Statistics
?
PSSM-Id: 177112
View PSSM: MTH00037
Aligned: 29 rows
Threshold Bit Score: 842.184
Threshold Setting Gi: 289183207
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
MTH00037 is a member of the superfamily cl00275.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

gi 49147333   10 LYISRWFFSTNHKDIGTLYLIFGAWAGTVGTAMSNIIRVELSQPGSLIQNDQTYNVIVTAHAFIMIFFMVMPIMIGGFGN 89
gi 5835460     1 MQLSRWLFSTNHKDIGTLYFLFGAWAGMVGTALSIIIRTELSQPGSFLGDDQIYNVIVTSHALIMIFFMVMPIMIGGFGN 80
gi 84488821    1 MQLSRWFFSTNHKDIGTLYFLFGSWAGMVGTALSIIIRAELAQPGSFLGDDQIYNVIVTSHALVMIFFMVMPVMIGGFGN 80
gi 84488724    1 MQLSRWLFSTNHKDIGTLYFLFGAWAGLVGTALSIIIRTELAQPGSFLGDDHIYNVVVTSHALIMIFFMVMPIMIGGFGN 80
gi 188039029   1 MQISRWFFSTNHKDIGTLYFLFGAWAGMLGTALSIIIRMELAQPGSFLGDDQIYNVVVTSHALIMIFFMVMPIMIGGFGN 80
gi 188039015  10 LYISRWFFSTNHKDIGTLYLIFGAWAGTVGTAMSNIIRVELSQPGSLIQNDQTYNVIVTAHAFIMIFFMVMPIMIGGFGN 89
gi 289183207   8 NYINRWLFSTNHKDIGTLYLIFGSWAGTVGTAMSNIIRVELSQPGSLIQNDQIYNVMVTSHALIMIFFMVMPIMIGGFGN 87
gi 289183151   8 NYISRWLFSTNHKDIGTLYLIFGAWAGTVGTAMSNIIRVELSQPGSLIQDDQLYNVMVTAHAFVMIFFMVMPIMIGGFGN 87
gi 289183180   9 NYIARWLFSTNHKDIGTLYLIFGAWAGTIGTAMSNIIRVELSQPGSLIQDDQVYNVMVTAHAFVMIFFMVMPIMIGGFGN 88
gi 304322867   1 MNLSRWLFSTNHKDIGTLYLIFGAWAGMVGTAMSVIIRTELAQPGSLLQDDQIYNVVVTAHALVMIFFMVMPIMIGGFGN 80

gi 49147333   90 WLVPLMIGAPDMAFPRMNNMSFWLIPPSFLLLIASAGNESGVGTGWTVYPPLSGPVAHAGGCVDLAIFSLHLAGASSIMA 169
gi 5835460    81 WLIPLMIGAPDLAFPRVNNMSFWLLPPSFLLLLASAGVESGAGTGWTIYPPLSSGLAHSGGSVDLAIFSLHIAGASSIVA 160
gi 84488821   81 WLIPLMIGAPDLAFPRVNNMSFWLLPPSFLLLLASAGVESGVGTGWTIYPPLSSGIAHAGGSVDFAIFSLHIAGASSIIA 160
gi 84488724   81 WLIPLMIGAPDLAFPRVNNMSFWLLPPSFVLLLASAGVESGVGTGWTIYPPLSSGLAHAGGSVDLAIFSLHIAGASSIVA 160
gi 188039029  81 WLIPLMIGAPDLAFPRVNNMSFWLLPPSFLLLLASAGVESGVGTGWTIYPPLSSGLAHAGGSVDLAIFSLHIAGASSIIA 160
gi 188039015  90 WLVPLMIGAPDMAFPRMNNMSFWLIPPSFLLLVASAGNESGVGTGWTVYPPLSGPVAHAGGCVDLAIFSLHLAGASSIMA 169
gi 289183207  88 WLVPLMIGAPDMAFPRMNNMSFWLIPPSFLLLLASAGNESGVGTGWTLYPPLSGPTAHGGGCVDLAIFSLHLAGASSIMA 167
gi 289183151  88 WLVPLMIGAPDMAFPRMNNMSFWLVPPAFLLLMASAGNESGVGTGWTAYPPLSGPVAHAGGCVDLAIFSLHLAGASSIMA 167
gi 289183180  89 WLVPLMIGAPDMAFPRMNNMSFWLIPPAFMLLLTSAGNESGVGTGWTVYPPLSGPVAHGGGCVDLAIFSLHLAGASSIMA 168
gi 304322867  81 WLIPLMIGAPDMAFPRMNNMSFWLVPPSFILLLASAGVESGVGTGWTIYPPLSSNIAHAGGSVDLAIFSLHLAGASSILA 160

gi 49147333  170 SINFITTIINMRAPGMSMDRTPLFVWSILITTFLLLLSLPVLAGAITMLLTDRNINTSFFDPTGGGDPILFQHLFWFFGH 249
gi 5835460   161 SINFITTVINMRSPGVTFDRLPLFVWSAFITAFLLLLSLPVLAGAITMLLTDRNINTTFFDPAGGGDPILFQHLFWFFGH 240
gi 84488821  161 SINFITTIINMRAPGVTFDRLSLFVWSIFITTFLLLLSLPVLAGAITMLLTDRNVNTTFFDPAGGGDPILFQHLFWFFGH 240
gi 84488724  161 SINFITTIINMRSPGVTFDRLPLFVWSVFITTFLLLLALPVLAGAITMLLTDRNVNTTFFDPAGGGDPILFQHLFWFFGH 240
gi 188039029 161 SINFITTVINMRSPGVTFDRLPLFVWSAFITAFLLLLSLPVLAGAITMLLTDRNVNTTFFDPAGGGDPILFQHLFWFFGH 240
gi 188039015 170 SINFITTIINMRAPGMTMDRTPLFVWSILITTFLLLLSLPVLAGAITMLLTDRNINTSFFDPTGGGDPILFQHLFWFFGH 249
gi 289183207 168 SINFISTIINMRAPGMTLDRTPLFVWSILITTFLLLLSLPVLAGAITMLLTDRNINTTFFDPTGGGDPILFQHLFWFFGH 247
gi 289183151 168 SINFITTIINMRSPGMTMDRVPLFVWSILITTVLLLLSLPVLAGAITMLLTDRNINTTFFDPTGGGDPILFQHLFWFFGH 247
gi 289183180 169 SINFITTIINMRAPGMSMDRTPLFVWSILLTTILLLLSLPVLAGAITMLLTDRNINTSFFDPTGGGDPVLYQHLFWFFGH 248
gi 304322867 161 SINFITTIINMRTPGVTFDRLPLFVWSVFITAFLLLLSLPVLAGAITMLLTDRNINTTFFDPAGGGDPILFQHLFWFFGH 240

gi 49147333  250 PEVYILILPGFGIISHVVTNRTGSNNPFGYLGMMYAMIAIGILGFIVWAHHMFTVGLDVDTRAYFTAATMIIAIPTGVKV 329
gi 5835460   241 PEVYILILPGFGMISHVVAHYSGKQEPFGYLGMVYAMVAIGILGFLVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKV 320
gi 84488821  241 PEVYILILPGFGMISHVVSHYSGKSEPFGYLGMVYAMVAIGILGFLVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKV 320
gi 84488724  241 PEVYILILPGFGMISHVVAHYSGKSEPFGYLGMVYAMVAIGVLGFLVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKV 320
gi 188039029 241 PEVYILILPGFGIISHVVAHYSGKKEPFGYLGMVYAMVAIGVLGFLVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKV 320
gi 188039015 250 PEVYILILPGFGIISHVVTNRTGKQQPFGYLGMMYAMITIGILGFIVWAHHMFTVGLDVDTRAYFTAATMIIAIPTGVKV 329
gi 289183207 248 PEVYILILPGFGIISHVVTNRTGKNQPFGYLGMMYAMIAIGILGFIVWAHHMFTVGLDVDTRAYFTAATMIIAIPTGVKV 327
gi 289183151 248 PEVYILILPGFGIISHIVTSRTGKQQPFGYLGMMYAMIAIGILGFIVWAHHMFTVGLDVDTRAYFTAATMIIAIPTGVKV 327
gi 289183180 249 PEVYILILPGFGIISHVVTSRTGKQQPFGYLGMMYAMISIGILGFIVWAHHMFTVGLDVDTRAYFTAATMIIAIPTGVKV 328
gi 304322867 241 PEVYILILPGFGMISHVIAHYSGKQEPFGYLGMVYAMVAIGILGFLVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKV 320

gi 49147333  330 FSWLATLQGVPFNIN.[3].PSLLWAIGFIFLFTVGGLTGIVLSNSSLNVALHDTYYVTAHFHYVLSMGAVFAIFSGFNH 407
gi 5835460   321 FSWMATLQGSNIRWD     VPLFWALGFIFLFTLGGLTGVVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAIFSGFTH 395
gi 84488821  321 FSWMATLQGSSLRWE     APLFWALGFIFLFTLGGLTGVVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAIFSGFTH 395
gi 84488724  321 FSWMATLQGSNLRWD     APLLWALGFIFLFTVGGLTGVVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAIFSGFVH 395
gi 188039029 321 FSWMATLQGSNISWD     APLLWALGFIFLFTLGGLTGVVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAIFSGFTH 395
gi 188039015 330 FSWLATLQGVPFNIN.[3].PSLMWAIGFIFLFTVGGLTGIVLSNSSLNVALHDTYYVTAHFHYVLSMGAVFAIFSGFNH 407
gi 289183207 328 FSWLATLQGTSLTIN.[3].PSLMWALGFIFLFTIGGLTGIILSNSSLNIALHDTYYVTAHFHYVLSMGAVFAIFSGFNH 405
gi 289183151 328 FSWLATLQGVPFYIN.[3].PSLLWALGFIFLFTVGGLTGIVLSNSSLNVALHDTYYVTAHFHYVLSMGAVFAIFAGFNH 405
gi 289183180 329 FSWLATLQGVSFFSN.[3].PSVMWALGFIFLFTIGGLTGIILSNSSLDVALHDTYYVTAHFHYVLSMGAVFAIFAGFNH 406
gi 304322867 321 FSWMATLQGSKLVWE     TPLLWALGFVFLFTVGGLTGIVLANSSIDVILHDTYYVVAHFHYVLSMGAVFAIFSGFTH 395

gi 49147333  408 WFPLLQGAQLDNTSATTHFILMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAFAFWNTVSSLGSLLSFIGTIGFLTIVALS 487
gi 5835460   396 WFPLFSGVGFHPQLSKVQFFIMFIGVNLTFFPQHFLGLAGMPRRYADYPDAYVSWNLVSSIGSIISLVAVIFFIFLVWEA 475
gi 84488821  396 WFPLFSGVGFHPQLSKVQFVIMFIGVNLTFFPQHFLGLAGMPRRYADYPDAYTSWNMVSSIGSVISLVAVIFFMFLVWES 475
gi 84488724  396 WFPLFSGVSLHAQLAKVHFFLMFIGVNLTFFPQHFLGLAGMPRRYADYPDVYTSWNVVSSIGSVISFVAVIFFIFLVWEA 475
gi 188039029 396 WFSLFSGVGLHPQLSKIQFFLMFIGVNLTFFPQHFLGLAGMPRRYADYPDAYMSWNLVSSIGSVISLIAVVFFMFLVWEA 475
gi 188039015 408 WFPLFTGANLDHTSATTHFILMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAFTFWNTVSSLGSLLSFIGTIGFLTIVALS 487
gi 289183207 406 WFSLFTGCHLDETGATTHFILMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAFTFWNTLSSLGSLLSFISTIGFLTIVILS 485
gi 289183151 406 WFSLFTGAQLDQTSATAHFILMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAFAFWNTVSSLGSLLSFIATIGFLTIVTLS 485
gi 289183180 407 WFQLFTGAHLDHTSATAHFFIMFLGVNLTFFPQHFLGLAGMPRRYSDYPDAFTFWNTVSSFGSLLSFIGTIGFLTIVILS 486
gi 304322867 396 WFPLFSGTALHPLWSKVQFFIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTWNTVSSIGSIISLVGALFFLFLIWEA 475

gi 49147333  488 LNNTNTNTSTNEITTNLEWFYPSYPPQEHTFNEMPTSWKSIN 529
gi 5835460   476 FVVRRSVLLPSYVSSSLEWQYSFFPPSHHTYNETPFVVLINS 517
gi 84488821  476 FVVRREVISPDYSFSSLEWQYSFFPPSHHTFDETPFVVVIRS 517
gi 84488724  476 FVVRREVVSPGFSSSFLEWQYSSFPPGHHTYDETPFVVMVSS 517
gi 188039029 476 FIVRRVVISPDFSSSSLEWQYNFFPPSHHTYEETPFVVIINL 517
gi 188039015 488 LSNNNINTSTNEAISNLEWHYPIYPPQEHTFNEMPISWNSIN 529
gi 289183207 486 LNNTNNNYFNNEISNNLEWHYPLFPPQEHTFNETPLSIINTN 527
gi 289183151 486 FTTNSVNTHTNDSISNLEWHYPNFPPQEHTFNEMPIGAGTAK 527
gi 289183180 487 IFSKNENTHTNEIATSLEWHYPEFPPQEHTFNETPTGHKSPI 528
gi 304322867 476 FASQRPVPAPSFVPASLEWQYESFPPSHHTFEETPTTFLPIK 517
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap