Conserved Protein Domain Family
GH4_alpha_glucosidase_galactosidase

?
cd05297: GH4_alpha_glucosidase_galactosidase 
Click on image for an interactive view with Cn3D
Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases.
Glucosidases cleave glycosidic bonds to release glucose from oligosaccharides. Alpha-glucosidases and alpha-galactosidases release alpha-D-glucose and alpha-D-galactose, respectively, via the hydrolysis of alpha-glycopyranoside bonds. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the alpha-glucosidases. Other organsisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. Alpha-glucosidases and alpha-galactosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
BioAssay Targets and Results
?
CID: 29435
AID: 244000
GI: 113498
more
Percent inhibition against Escherichia coli galactosidase at 0.24 mM; n>=3
Target Name: Alpha-galactosidase
Chemical Name: 1-DEOXYNOJIRIMYCIN
CID: 44397757
AID: 243999
GI: 113498
more
Percent inhibition against Escherichia coli galactosidase at 0.24 mM; n>=2
Target Name: Alpha-galactosidase
Chemical Name: CHEMBL434336
CID: 45263220
AID: 243999
GI: 113498
more
Percent inhibition against Escherichia coli galactosidase at 0.24 mM; n>=2
Target Name: Alpha-galactosidase
Chemical Name: DEOXYGALACTONOJIRIMYCIN
Statistics
?
PSSM-Id: 133433
View PSSM: cd05297
Aligned: 46 rows
Threshold Bit Score: 488.613
Threshold Setting Gi: 3915760
Created: 20-Dec-2005
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
Hierarchy
?
Display:
 
Conserved site includes 15 residues -Click on image for an interactive view with Cn3D
Feature 1:NAD binding site [chemical binding site]
Evidence:

cd05297 is part of a hierarchy of related CD models.
Use the graphical representation to navigate this hierarchy.
cd05297 is a member of the superfamily cl21454.
cd00300:LDH_likecd00650:LDH_MDH_likecd00704:MDHcd01336:MDH_cytoplasmic_cytosoliccd01337:MDH_glyoxysomal_mitochondrialcd01338:MDH_choloroplast_likecd01339:LDH-like_MDHcd05197:GH4_glycoside_hydrolasescd05290:LDH_3cd05291:HicDH_likecd05292:LDH_2cd05293:LDH_1cd05294:LDH-like_MDH_nadpcd05295:MDH_likecd05296:GH4_P_beta_glucosidasecd05297:GH4_alpha_glucosidase_galactosidasecd05298:GH4_GlvA_pagL_like1OBB B1670390571573642411609016171500206591542500311VJT A20690110015643200160902319206901539126465608159041403119720416829466753993345588712614391576014629773320690021116088097916093876615381621146915118179056014026146156741863171059913671536581542523851162489263912990892113321573713421538896352121907611846879220690091720690055314629657415038411516093428456908427118725381140261411538907671OBB B1670390571573642411609016171500206591542500311VJT A2069011001564320016090231920690153912646560815904140311972041682946675399334558871261439157601462977332069002111608809791609387661538162114691511817905601402614615674186317105991367153658154252385116248926391299089211332157371342153889635212190761184687922069009172069005531462965741503841151609342845690842711872538114026141153890767
cd05297 Sequence Cluster
cd05297 Sequence Cluster
Sub-family Hierarchy
Click to see CD Hierarchy help
 cd05297 Branch
 Whole Hierarchy
 [Download CDTree]
CD Hierarchy
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

Feature 1                ##                                 ##   #                               
1OBB_B         4 VKIGIIGAGSA.[1].FSLRLVSDLCKT.[1].GLSGSTVTLMDIDEERLDAILTIAKKYVEEVG.[3].KFEKTMNLDD 73
1VJT_A        13 XKISIIGAGSV.[1].FALQLVGDIAQT.[3].SREDTHIYXXDVHERRLNASYILARKYVEELN.[3].KIVKTSSLDE 84
gi 150020659   2 FKVAIVGAGSA.[1].FSLRIISDFTKI.[1].EFKDVEIYLMDIDETRLNSTFILANKLNEEMG.[3].KFKTTTNLEE 71
gi 15643200    2 PTIVFVGAGSV.[1].YTIKLVGDLAKT.[1].DLYGSRLVLMDIDEERLKATYILVTKYLRELN.[3].TVEQTTSLEE 71
gi 160902319   3 VKISFIGAGSV.[1].YTVKLVGDLAKT.[1].ELNGSLISFMDIDEERLNAVDNLAKRYTEEIG.[3].KFEKTTNREK 72
gi 206901100   1 MKIAIVGAGSI.[1].FSLQIIGDIAKT.[1].ELSGSLISMIDVHEERLNASYILAKKYVEEIG.[3].RFEKTKRLEE 70
gi 206901539   2 VKISIIGAGSV.[1].FSMKLIQDLNYY.[1].DLSGSTVVFMDINEERLDLVYTLADKYMKETG.[3].KLEKTTDRKK 71
gi 126465608   7 IKISIIGAGSA.[1].WSIPVLIDIMLK.[1].SLANADVYLMDIDLDRLKLVYGFAKRYAEEIH.[3].KFHMTTDRVE 76
gi 154250031   4 LKIAIIGAGSA.[1].FSMKIVSDLCKV.[1].KLKGSHVVLMDIDERRLHNVYVLTKELSRVFD.[3].DIETTTDMQK 73
gi 159041403   7 FKIALIGAGSA.[1].WAIGLIKDLALI.[1].SLSGSTVVLMDIDEDRLALVSRFAKRYVSEVK.[3].NIVTTTDRRE 76

Feature 1                  ###       ##                            #               #             
1OBB_B        74 VIIDADFVINTAMVG     GHTYLEKVRQIGEKYGYY.[5].QEFNMVSDYYTFSNYNQL.[1].YFVDIARKIEKLSP 144
1VJT_A        85 AIDGADFIINTAYPY.[7].GSQRWDEVTKVGEKHGYY.[5].QELNXVSTYTYVLSSYPD.[2].LALEIAEKXKKXAP 163
gi 150020659  72 AIDGAMFVINTAMAG     GHDYLEKVRKIGEKWGYY.[5].QEFNMVSDYYTISNFNQL.[1].LFLKVARLVEEKGE 142
gi 15643200   72 ALEGADFVINTALYR.[6].GYVHYEIMREVGERHGYY.[5].QELNMVSDYYTLSNYNHL.[1].MSLDIAKAVEKIAP 148
gi 160902319  73 SLKDADFVINTALYR.[6].GYVSYEIMRDVAEKYGYY.[5].QEFNMVSDYYTFTNYNHL.[1].LSLDIAKSIEKICP 149
gi 206901100  71 GIEGADFIINTALPF.[6].GFIKYDIVTQIGEKHGYY.[5].QELNMVSTYTYVLISYYD.[2].LAIDIAKAMKKYAP 148
gi 206901539  72 AIDGADFVINTVKVG     GYHNMEKEREIAESLGYY.[1].GFGDRVSDYYGGFAAYEQ.[2].FIRELAKDVEKFAP 139
gi 126465608  77 AIRDADFVINSAMAM     GHSYYERMREISEKHGYY.[5].VEWNMVSDYHTIWGYYQF.[1].LAMSIARNIEEYAP 147
gi 154250031  74 AIEGADFVINTAMAG     GHDYLDKVRAIGEKHGYY.[5].QNYNFVSDYLNLTNWNQF.[1].LFLKIAKMIEKFAP 144
gi 159041403  77 AIRDADFVVNSTLAK     GHGHYERMREVSEKYGYY.[5].VEWNMVSDYHTIWGYYQF.[1].LALDIANDVVDYAP 147

Feature 1                   # #                       #                                          
1OBB_B       145      KAWYLQAANPIFEGTTLVTRTV.[1].IKAVGFXHGHYGVMEIVEKLG.[3].EKVDWQVAGVNHGIWLNRFRYN 213
1VJT_A       164      KAYLXQTANPVFEITQAVRRWT.[1].ANIVGFCHGVAGVYEVFEKLD.[3].EEVDWQVAGVNHGIWLNRFRYR 232
gi 150020659 143 .[1].GAWLLQAANPVFEGTTLILRNV.[1].INMVGFCHGHYGIHYLAETIG.[3].NKVDWQVAGVNHGIWLNRFLYN 212
gi 15643200  149      NAWILQTANPVFEITQLVKRLT.[1].AKIVGFCHGYAHVFHLAKVLG.[3].EELDWQVAGVNHAIWMNRFRCR 217
gi 160902319 150      NAWLIQTANPVFEITQLIKRLT.[1].VKVVGFCHGVGGVHEVLKTLR.[3].NETDWQVAGVNHGIWLNRFLYK 218
gi 206901100 149      SSWLLQTANPVFEITQLLNRLT.[1].INVVGICHGFHGVYEVFNSLR.[3].KEVDWQVAGVNHGIFLNRFLYR 217
gi 206901539 140      DAWYMQVSNPVFEGTNLALRET.[1].LKVVGFCHGYLELFHLIRVLG.[3].KDVEEQVAGFNHSIFLTKFKYK 208
gi 126465608 148      DAWLLNVANPVFELTTLISRKT.[1].VKMIGLCHGHMGFENVIRELK.[3].DKVEAEIIGFNHVIWLTKFKVD 216
gi 154250031 145      NAWYLQAANPVFEGTTLVSTQT.[1].IKMVGFCHGHYAVESLANLIG.[1].KEYDWQVGGVNHGIWLTKFTTK 211
gi 159041403 148      NAWLLNVSNPVFELTTLISRET.[1].ARVIGLCDGYYAYRDLLRVLG.[3].GKAEVEVIGVNHDDWLTRLKYN 216

Feature 1                                                                                        
1OBB_B       214      GGNAYPLLDKWIEEKS.[12].LSPAAIDMYRFYGVMPIGDTVRNS     SWRYHRDLETKKK.[16].WYQDT 299
1VJT_A       233      GEDAYPLLDEWIEKKL.[12].XSPAAXDXYKFYGXLPIGDTVRNG     SWKYHYNLETKKK.[15].KFHEQ 317
gi 150020659 213      GKNAYEILDEWIKNNV.[10].LSKVAIDMYKFYGQMPIGDTVRNS     SWKYHYNLETKKK.[ 6].GADSE 286
gi 15643200  218      GEDLYPKLDEWIEENA.[12].FSPAAIDMYRFYGMYPIGDTVRSG     TWKYHYDLETKKR.[15].KFYES 302
gi 160902319 219      GEDGYQILDKWIEEES.[12].LAPAVIDMYKFYGLLPIGDTTRNS     TWKHHHSLQAKKK.[15].KFYEE 303
gi 206901100 218      GKNAYPLLDEWIEKES.[12].MSPAVMDMYKFYGMLPIGDACRNG     TWKYNYNLETKKK.[15].KFHEE 302
gi 206901539 209      GENAYPLIDKWIEEEA.[18].LSPASVEMYRLYGLFPIGDTPRAV.[1].PWWFHTDLNEKKK.[ 5].GPDSE 290
gi 126465608 217      GEDGYKFLDKWIVTEA.[18].LSPAAIDMYKNYGLLPIGDTVRGG     TWKYHWNLETKKK.[ 6].GPDSE 298
gi 154250031 212 .[1].GKDLYPEIDKYKGKIQ.[10].LSPVAWDMYDFYGLFPIGDTVRNS     TWKYHRDLETKKR.[ 7].GADSE 287
gi 159041403 217      GEDAYHLIDEWISTKS.[18].VSPVAVDMYRMYGLWPIGDTVRSG     TWKYHWDLKTKQY.[ 6].GPDSE 298

Feature 1                                                                                       
1OBB_B       300 LGKVTEITKKVAK.[37].RKSGEQHIPFIDALLNDNKARFVVNIPNKGIIHGIDDDVVVEVPALVDKNGIHPEKIEPP 409
1VJT_A       318 LRRARERLIKLAE.[21].KLSGEQHIPFINAIANNKRVRLFLNVENQGTLKDFPDDVVXELPVWVDCCGIHREKVEPD 411
gi 150020659 287 IGWKWYQDNLKAI.[45].KLSGEQHVPFIDSIVNNKRQRFVVNILNNGVIEGIDNDVAVEIPAWVDSSGIHSEEITPK 404
gi 15643200  303 LREQRKRLMELAK.[21].SESVEQHIPFINALVNDKKARLVLNVENRGVIKGIPDDVMVEVPVVVDKEGIHPEKIEPD 396
gi 160902319 304 LRQTKRMIIQVSK.[17].KMSGEQQVPFINALTNDVEARLFLNVLNDGTIKNIPNDVVVEVPVKVNKNGIFPEKIQPD 393
gi 206901100 303 LRKGRKRMIEIAK.[21].KLSGEQHIHFIKSITGKGKSRLILNIPNRGTLSGIPDDVVVEVPVWVDETGIKPEKIEPD 396
gi 206901539 291 IGWTMYLYGLKMR.[21].EESMESIIPFVDAIVNNHRRRLVLNVPNQGAIPGIPDDVIVEIPVYVDKNGIEREKIEKI 384
gi 126465608 299 IGWAMYVAFLKMR.[21].KPSGEQVIELIDSMVTGTPRTFQVNILNNGSIPGIPDNVAVEMPAVIDDKGVHRKTFPPL 392
gi 154250031 288 LGWKWYVEQLYKV.[45].KLSGEQHVPFIDSVVNGTKRRFVVNMINKGKIKGIDDDVAVEICAWVSGENIEFEETHLP 405
gi 159041403 299 IGWAMYLTWHKIE.[22].RSEGEPVTMVIEAIVEDSGKVIEVNVPNQDAIPGIPSDVAVEMPARVDAKGVHRLSFSNL 393

Feature 1                                                                              
1OBB_B       410 .[2].DRVVKYYLRPRIMRMEMALEAFL.[1].GDIRIIKELLYRDP.[1].TKSDEQVEKVIEEILALP 468
1VJT_A       412 .[2].HRIKIFYLWPRILRXEWNLEAYI.[1].RDRKVLEEILIRDP.[1].TKSYEQIVQVLDEIFNLP 470
gi 150020659 405 .[2].ERVIKYYLRPRIMRMELASEAFL.[1].GDIKLLKEILFRDP.[1].TKSEEQVEGVLNEIMNLP 463
gi 15643200  397 .[2].DRIKKFYLLPRILRMEWTLEAFI.[1].GDRRVLEEILVRDP.[1].TRSYEQAVAVIDDILNLP 455
gi 160902319 394 .[2].EKIKNYYIIPRITRMEMALEAFI.[1].GNRNILEEVLVRDP.[1].TKNYDDIPKLWDEIFDLP 452
gi 206901100 397 .[2].HRIKIFYLMPRILRMEWALEGFI.[1].KDIKVLEEILVRDP.[1].TKSYEQVLAVLDEILTQP 455
gi 206901539 385 .[1].SRLMLYVLIPRWLRMERILQAFQ.[1].GDRISLLLMVMDDP.[1].TKSFEQGKNLVETMLSQP 442
gi 126465608 393 .[1].SKIQKYVIYPRMMRMEWALEAFL.[1].GGRDKLFEWLIYDP.[1].TKSTRQVEETIDDLLKMP 450
gi 154250031 406      ERVINWYIKPRVLLAKQALEAFL.[1].KDTKLVADIIERDW.[1].TKSSEQVKKLIDELYPFV 462
gi 159041403 394 .[4].GKVLKYAIMPRVIRGEWAIEAFL.[1].GGRDTLFNWLIIDP.[1].TKSSDQVNQVIDAILKIP 454

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D
Conserved site includes 15 residues -Click on image for an interactive view with Cn3D