NCBI CDD Logo
?
pfam00105: zf-C4, with user query added  
Click on image for an interactive view with Cn3D
Zinc finger, C4 type (two domains)
In nearly all cases, this is the DNA binding domain of a nuclear hormone receptor. The alignment contains two Zinc finger domains that are too dissimilar to be aligned with each other.
Statistics
?
PSSM-Id: 249591
View PSSM: pfam00105
Aligned: 27 rows
Threshold Bit Score: 101.129
Threshold Setting Gi: 209156451
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
pfam00105 is a member of the superfamily cl02596.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1DSZ_A         5 KPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSK 74
query          1 ---------------------------------------------------------mRLSKTLVDMDMA 13
gi 14917017  266 KMCAVCNDRAVCLHYGARTCEGCKGFFKRTVQKNSKYTCAGNKTCPIDKRYRSRCQYCRYQKCLEVGMVK 335
gi 127819    265 GRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVK 334
gi 416584     11 ELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMRL 80
gi 121069    419 KLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNL 488
gi 215274146  77 RLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQACRFTKCLRVGMLK 146
gi 34223729  365 VPCKVCGDKASGYHYGVTSCEGCKGFFRRSIQKQIEYRCLRDGKCLVIRLNRNRCQYCRFKKCLSAGMSR 434
1KB6_B         7 RICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMK 76
1R0O_B         7 ELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRP 76
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D