|
NCBI Home IEB Home C Toolkit docs C++ Toolkit source browser C Toolkit source browser (2) |
NCBI C Toolkit Cross ReferenceC/demo/delta.prt |
source navigation diff markup identifier search freetext search file search |
1 Seq-entry ::= set {
2 level 1 ,
3 class nuc-prot ,
4 date
5 str "15-DEC-1989" ,
6 descr {
7 title "A.variabilis nifD gene 5' recombination site. and translated
8 products" ,
9 org {
10 taxname "Anabaena variabilis" } } ,
11 seq-set {
12 set {
13 level 2 ,
14 class segset ,
15 descr {
16 title "A.variabilis nifD gene 5' recombination site." } ,
17 seq-set {
18 seq {
19 id {
20 giim {
21 id 86659 } } ,
22 descr {
23 title "A.variabilis nifD gene 5' recombination site." } ,
24 inst {
25 repr delta ,
26 mol dna ,
27 length 502 ,
28 ext
29 delta {
30 loc
31 whole
32 giim {
33 id 86657 } ,
34 literal { length 5, seq-data iupacna "GGGGG" },
35 loc
36 whole
37 giim {
38 id 86658 } } } } ,
39 set {
40 level 3 ,
41 class parts ,
42 seq-set {
43 seq {
44 id {
45 giim {
46 id 86657 } ,
47 genbank {
48 name "ANANIFDR1" ,
49 accession "M28152" } } ,
50 descr {
51 title "A.variabilis nifD gene 5' recombination site." ,
52 genbank {
53 source "Anabaena variabilis (strain ATCC 29413) vegetative
54 cell DNA, cosmid 33D12." ,
55 keywords {
56 "nifD gene" ,
57 "nitrogenase" } } } ,
58 inst {
59 repr raw ,
60 mol dna ,
61 length 204 ,
62 topology linear ,
63 strand ds ,
64 seq-data
65 ncbi2na '36306514D3F38E1BC597183F822F6C0270825E3F0D9F7ACF022
66 0B3B7D4023A77D5F5B40E477EA3C75817263AAE40ED2348C2BF41'H } ,
67 annot {
68 {
69 data
70 ftable {
71 {
72 data
73 imp {
74 key "misc_recomb" } ,
75 location
76 int {
77 from 152 ,
78 to 162 ,
79 id
80 giim {
81 id 86657 } ,
82 fuzz-to
83 lim tl } ,
84 qual {
85 {
86 qual "note" ,
87 val "nifD recombination site" } } } ,
88 {
89 data
90 pub {
91 pub {
92 gen {
93 cit "Journal=""Unpublished (1989) Dept. of
94 Bio., TA&M, College Station, TX 77843""," ,
95 authors {
96 names
97 str {
98 "Brusca,J.S." } } } } } ,
99 location
100 int {
101 from 183 ,
102 to 203 ,
103 id
104 giim {
105 id 86657} } } ,
106 {
107 data
108 pub {
109 pub {
110 muid 89327123 ,
111 article {
112 title {
113 name "Excision of an 11-kilobase-pair DNA
114 element from within the nifD gene in Anabaena variabilis heterocysts" } ,
115 authors {
116 names
117 str {
118 "Brusca,J.S." ,
119 "Hale,M.A." ,
120 "Carrasco,C.D." ,
121 "Golden,J.W." } } ,
122 from
123 journal {
124 title {
125 name "J. Bacteriol." } ,
126 imp {
127 date
128 std {
129 year 1989 } ,
130 volume "171" ,
131 pages "4138-4145" } } } } } ,
132 location
133 int {
134 from 133 ,
135 to 182 ,
136 id
137 giim {
138 id 86657}} } } } } } ,
139 seq {
140 id {
141 giim {
142 id 86658 } ,
143 genbank {
144 name "ANANIFDR2" ,
145 accession "M28153" } } ,
146 descr {
147 title "A.variabilis nifD gene 3' recombination site, and xisA
148 gene, 5' end." ,
149 genbank {
150 source "Anabaena variabilis (strain ATCC 29413) vegetative
151 cell DNA, cosmid 33D12." ,
152 keywords {
153 "nifD gene" ,
154 "nitrogenase" ,
155 "xisA gene" } ,
156 origin "About 10.7 kb after segment 1." } } ,
157 inst {
158 repr raw ,
159 mol dna ,
160 length 293 ,
161 topology linear ,
162 strand ds ,
163 seq-data
164 ncbi2na '1FFBDD3BBDDFE79EE7E487E258801E5B6B2380BA750B79029FB
165 E33FB7E15E3FE4D9EEB3C9733F25C00F0EEF349010EF4D1C11E74B9013C27BE0273C0510028F1D
166 695F346BC61A3F9CDC0'H } ,
167 annot {
168 {
169 data
170 ftable {
171 {
172 data
173 imp {
174 key "misc_recomb" } ,
175 location
176 int {
177 from 249 ,
178 to 259 ,
179 id
180 giim {
181 id 86658 } ,
182 fuzz-to
183 lim tl } ,
184 qual {
185 {
186 qual "note" ,
187 val "nifD recombination site" } } } ,
188 {
189 data
190 pub {
191 pub {
192 gen {
193 cit "Journal=""Unpublished (1989) Dept. of
194 Bio., TA&M, College Station, TX 77843""," ,
195 authors {
196 names
197 str {
198 "Brusca,J.S." } } } } } ,
199 location
200 int {
201 from 276 ,
202 to 292 ,
203 id
204 giim {
205 id 86658} } } ,
206
207 {
208 data
209 pub {
210 pub {
211 muid 89327123 ,
212 article {
213 title {
214 name "Excision of an 11-kilobase-pair DNA
215 element from within the nifD gene in Anabaena variabilis heterocysts" } ,
216 authors {
217 names
218 str {
219 "Brusca,J.S." ,
220 "Hale,M.A." ,
221 "Carrasco,C.D." ,
222 "Golden,J.W." } } ,
223 from
224 journal {
225 title {
226 name "J. Bacteriol." } ,
227 imp {
228 date
229 std {
230 year 1989 } ,
231 volume "171" ,
232 pages "4138-4145" } } } } } ,
233 location
234 int {
235 from 10 ,
236 to 275 ,
237 id
238 giim {
239 id 86658 }} } } } } } } } } } ,
240 seq {
241 id {
242 giim {
243 id 86660 } } ,
244 descr {
245 title "xisA peptide A (alt.)" ,
246 method concept-trans } ,
247 inst {
248 repr raw ,
249 mol aa ,
250 length 44 ,
251 seq-data
252 iupacaa "MQNQGQDKYQQAFADLEPLSSTDGSFLGSSLQAQQQREHMRTKV" } } ,
253 seq {
254 id {
255 giim {
256 id 86661 } } ,
257 descr {
258 title "xisA peptide B (alt.)" ,
259 method concept-trans } ,
260 inst {
261 repr raw ,
262 mol aa ,
263 length 5 ,
264 seq-data
265 iupacaa "MRTKV" } } } ,
266 annot {
267 {
268 data
269 ftable {
270 {
271 data
272 cdregion {
273 code {
274 id 1 } } ,
275 product
276 whole
277 giim {
278 id 86660 } ,
279 location
280 int {
281 from 0 ,
282 to 130 ,
283 strand minus ,
284 id
285 giim {
286 id 86658 } ,
287 fuzz-from
288 lim gt } ,
289 qual {
290 {
291 qual "note" ,
292 val "xisA peptide A (alt.)" } } } ,
293 {
294 data
295 cdregion {
296 code {
297 id 1 } } ,
298 product
299 whole
300 giim {
301 id 86661 } ,
302 location
303 int {
304 from 0 ,
305 to 13 ,
306 strand minus ,
307 id
308 giim {
309 id 86658 } ,
310 fuzz-from
311 lim gt } ,
312 qual {
313 {
314 qual "note" ,
315 val "xisA peptide B (alt.)" } } } } } } }
|
This page was automatically generated by the
LXR engine.
Visit the LXR main site for more information. |