NCBI C Toolkit Cross Reference

C/demo/delta.prt


  1 Seq-entry ::= set {
  2   level 1 ,
  3   class nuc-prot ,
  4   date
  5     str "15-DEC-1989" ,
  6   descr {
  7     title "A.variabilis nifD gene 5' recombination site. and translated
  8  products" ,
  9     org {
 10       taxname "Anabaena variabilis" } } ,
 11   seq-set {
 12     set {
 13       level 2 ,
 14       class segset ,
 15       descr {
 16         title "A.variabilis nifD gene 5' recombination site." } ,
 17       seq-set {
 18         seq {
 19           id {
 20             giim {
 21               id 86659 } } ,
 22           descr {
 23             title "A.variabilis nifD gene 5' recombination site." } ,
 24           inst {
 25             repr delta ,
 26             mol dna ,
 27             length 502 ,
 28             ext
 29               delta {
 30                           loc
 31                 whole
 32                   giim {
 33                     id 86657 } ,
 34               literal { length 5, seq-data iupacna "GGGGG" },
 35                           loc
 36                 whole
 37                   giim {
 38                     id 86658 } } } } ,
 39         set {
 40           level 3 ,
 41           class parts ,
 42           seq-set {
 43             seq {
 44               id {
 45                 giim {
 46                   id 86657 } ,
 47                 genbank {
 48                   name "ANANIFDR1" ,
 49                   accession "M28152" } } ,
 50               descr {
 51                 title "A.variabilis nifD gene 5' recombination site." ,
 52                 genbank {
 53                   source "Anabaena variabilis (strain ATCC 29413) vegetative
 54  cell DNA, cosmid 33D12." ,
 55                   keywords {
 56                     "nifD gene" ,
 57                     "nitrogenase" } } } ,
 58               inst {
 59                 repr raw ,
 60                 mol dna ,
 61                 length 204 ,
 62                 topology linear ,
 63                 strand ds ,
 64                 seq-data
 65                   ncbi2na '36306514D3F38E1BC597183F822F6C0270825E3F0D9F7ACF022
 66 0B3B7D4023A77D5F5B40E477EA3C75817263AAE40ED2348C2BF41'H } ,
 67               annot {
 68                 {
 69                   data
 70                     ftable {
 71                       {
 72                         data
 73                           imp {
 74                             key "misc_recomb" } ,
 75                         location
 76                           int {
 77                             from 152 ,
 78                             to 162 ,
 79                             id
 80                               giim {
 81                                 id 86657 } ,
 82                             fuzz-to
 83                               lim tl } ,
 84                         qual {
 85                           {
 86                             qual "note" ,
 87                             val "nifD recombination site" } } } ,
 88                       {
 89                         data
 90                           pub {
 91                             pub {
 92                               gen {
 93                                 cit "Journal=""Unpublished (1989) Dept. of
 94  Bio., TA&M, College Station, TX 77843""," ,
 95                                 authors {
 96                                   names
 97                                     str {
 98                                       "Brusca,J.S." } } } } } ,
 99                         location
100                           int {
101                             from 183 ,
102                             to 203 ,
103                                                         id
104                                                                 giim {
105                                                                         id 86657} } } ,
106                       {
107                         data
108                           pub {
109                             pub {
110                               muid 89327123 ,
111                               article {
112                                 title {
113                                   name "Excision of an 11-kilobase-pair DNA
114  element from within the nifD gene in Anabaena variabilis heterocysts" } ,
115                                 authors {
116                                   names
117                                     str {
118                                       "Brusca,J.S." ,
119                                       "Hale,M.A." ,
120                                       "Carrasco,C.D." ,
121                                       "Golden,J.W." } } ,
122                                 from
123                                   journal {
124                                     title {
125                                       name "J. Bacteriol." } ,
126                                     imp {
127                                       date
128                                         std {
129                                           year 1989 } ,
130                                       volume "171" ,
131                                       pages "4138-4145" } } } } } ,
132                         location
133                           int {
134                             from 133 ,
135                             to 182 ,
136                                                         id
137                                                                 giim {
138                                                                         id 86657}} } } } } } ,
139             seq {
140               id {
141                 giim {
142                   id 86658 } ,
143                 genbank {
144                   name "ANANIFDR2" ,
145                   accession "M28153" } } ,
146               descr {
147                 title "A.variabilis nifD gene 3' recombination site, and xisA
148  gene, 5' end." ,
149                 genbank {
150                   source "Anabaena variabilis (strain ATCC 29413) vegetative
151  cell DNA, cosmid 33D12." ,
152                   keywords {
153                     "nifD gene" ,
154                     "nitrogenase" ,
155                     "xisA gene" } ,
156                   origin "About 10.7 kb after segment 1." } } ,
157               inst {
158                 repr raw ,
159                 mol dna ,
160                 length 293 ,
161                 topology linear ,
162                 strand ds ,
163                 seq-data
164                   ncbi2na '1FFBDD3BBDDFE79EE7E487E258801E5B6B2380BA750B79029FB
165 E33FB7E15E3FE4D9EEB3C9733F25C00F0EEF349010EF4D1C11E74B9013C27BE0273C0510028F1D
166 695F346BC61A3F9CDC0'H } ,
167               annot {
168                 {
169                   data
170                     ftable {
171                       {
172                         data
173                           imp {
174                             key "misc_recomb" } ,
175                         location
176                           int {
177                             from 249 ,
178                             to 259 ,
179                             id
180                               giim {
181                                 id 86658 } ,
182                             fuzz-to
183                               lim tl } ,
184                         qual {
185                           {
186                             qual "note" ,
187                             val "nifD recombination site" } } } ,
188                       {
189                         data
190                           pub {
191                             pub {
192                               gen {
193                                 cit "Journal=""Unpublished (1989) Dept. of
194  Bio., TA&M, College Station, TX 77843""," ,
195                                 authors {
196                                   names
197                                     str {
198                                       "Brusca,J.S." } } } } } ,
199                         location
200                           int {
201                             from 276 ,
202                             to 292 ,
203                                                         id
204                                                                 giim {
205                                                                         id 86658} } } ,
206 
207                       {
208                         data
209                           pub {
210                             pub {
211                               muid 89327123 ,
212                               article {
213                                 title {
214                                   name "Excision of an 11-kilobase-pair DNA
215  element from within the nifD gene in Anabaena variabilis heterocysts" } ,
216                                 authors {
217                                   names
218                                     str {
219                                       "Brusca,J.S." ,
220                                       "Hale,M.A." ,
221                                       "Carrasco,C.D." ,
222                                       "Golden,J.W." } } ,
223                                 from
224                                   journal {
225                                     title {
226                                       name "J. Bacteriol." } ,
227                                     imp {
228                                       date
229                                         std {
230                                           year 1989 } ,
231                                       volume "171" ,
232                                       pages "4138-4145" } } } } } ,
233                         location
234                           int {
235                             from 10 ,
236                             to 275 ,
237                                                         id
238                                                                 giim {
239                                                                         id 86658 }} } } } } } } } } } ,
240     seq {
241       id {
242         giim {
243           id 86660 } } ,
244       descr {
245         title "xisA peptide A (alt.)" ,
246         method concept-trans } ,
247       inst {
248         repr raw ,
249         mol aa ,
250         length 44 ,
251         seq-data
252           iupacaa "MQNQGQDKYQQAFADLEPLSSTDGSFLGSSLQAQQQREHMRTKV" } } ,
253     seq {
254       id {
255         giim {
256           id 86661 } } ,
257       descr {
258         title "xisA peptide B (alt.)" ,
259         method concept-trans } ,
260       inst {
261         repr raw ,
262         mol aa ,
263         length 5 ,
264         seq-data
265           iupacaa "MRTKV" } } } ,
266   annot {
267     {
268       data
269         ftable {
270           {
271             data
272               cdregion {
273                 code {
274                   id 1 } } ,
275             product
276               whole
277                 giim {
278                   id 86660 } ,
279             location
280               int {
281                 from 0 ,
282                 to 130 ,
283                 strand minus ,
284                 id
285                   giim {
286                     id 86658 } ,
287                 fuzz-from
288                   lim gt } ,
289             qual {
290               {
291                 qual "note" ,
292                 val "xisA peptide A (alt.)" } } } ,
293           {
294             data
295               cdregion {
296                 code {
297                   id 1 } } ,
298             product
299               whole
300                 giim {
301                   id 86661 } ,
302             location
303               int {
304                 from 0 ,
305                 to 13 ,
306                 strand minus ,
307                 id
308                   giim {
309                     id 86658 } ,
310                 fuzz-from
311                   lim gt } ,
312             qual {
313               {
314                 qual "note" ,
315                 val "xisA peptide B (alt.)" } } } } } } }

source navigation ]   [ diff markup ]   [ identifier search ]   [ freetext search ]   [ file search ]  

This page was automatically generated by the LXR engine.
Visit the LXR main site for more information.