NCBI C Toolkit Cross Reference

C/demo/bioseq.set


  1 Bioseq-set ::= {
  2   level 0 ,
  3   class genbank ,
  4   release "66.0" ,
  5   date
  6     str "Apr 30, 1991 11:19 AM" ,
  7   descr {
  8     title "GenBank release 66.0 converted to ASN.1" } ,
  9   seq-set {
 10     seq {
 11       id {
 12         giim {
 13           id 1 } ,
 14         genbank {
 15           name "AGMAPHAAA" ,
 16           accession "M26844" } } ,
 17       descr {
 18         title "African green monkey alpha-DNA." ,
 19         genbank {
 20           source "African green monkey DNA." ,
 21           keywords {
 22             "alpha DNA" ,
 23             "alphoid repetitive sequence" } ,
 24           date "15-DEC-1989" } ,
 25         org {
 26           taxname "Cercopithecus aethiops" } ,
 27         pub {
 28           pub {
 29             muid 84259347 ,
 30             article {
 31               title {
 32                 name "A protein binds to a satellite DNA repeat at three
 33  specific sites that would be brought into mutual proximity by DNA folding in
 34  the nucleosome" } ,
 35               authors {
 36                 names
 37                   str {
 38                     "Strauss,F." ,
 39                     "Varshavsky,A." } } ,
 40               from
 41                 journal {
 42                   title {
 43                     name "Cell" } ,
 44                   imp {
 45                     date
 46                       std {
 47                         year 1984 } ,
 48                     volume "37" ,
 49                     pages "889-901" } } } } } } ,
 50       inst {
 51         repr raw ,
 52         mol dna ,
 53         length 208 ,
 54         topology linear ,
 55         strand ds ,
 56         seq-data
 57           ncbi2na '0F74EFE127CD36309FDE201EF7BBDEF0F4DD212F137F57E0425FD9C29EF
 58 7EE83E902A33FA055322A73AE00080CDF57D007A0209F00'H } } ,
 59     set {
 60       level 1 ,
 61       class segset ,
 62       date
 63         str "30-SEP-1988" ,
 64       descr {
 65         title "African green monkey endogenous retroviral 5' LTR, segment 1 of
 66  2." ,
 67         pub {
 68           pub {
 69             muid 85295965 ,
 70             article {
 71               title {
 72                 name "Nucleotide sequence analysis and enhancer function of
 73  long terminal repeats associated with an endogenous African green monkey
 74  retroviral DNA" } ,
 75               authors {
 76                 names
 77                   str {
 78                     "Kessel,M." ,
 79                     "Khan,A.S." } } ,
 80               from
 81                 journal {
 82                   title {
 83                     name "Mol. Cell. Biol." } ,
 84                   imp {
 85                     date
 86                       std {
 87                         year 1985 } ,
 88                     volume "5" ,
 89                     pages "1335-1342" } } } } } ,
 90         org {
 91           taxname "Cercopithecus aethiops" } } ,
 92       seq-set {
 93         seq {
 94           id {
 95             giim {
 96               id 4 } } ,
 97           descr {
 98             title "African green monkey endogenous retroviral 5' LTR, segment
 99  1 of 2." } ,
100           inst {
101             repr seg ,
102             mol dna ,
103             length 1162 ,
104             fuzz
105               lim gt ,
106             ext
107               seg {
108                 whole
109                   giim {
110                     id 2 } ,
111                 null NULL ,
112                 whole
113                   giim {
114                     id 3 } } } } ,
115         set {
116           level 3 ,
117           class parts ,
118           seq-set {
119             seq {
120               id {
121                 giim {
122                   id 2 } ,
123                 genbank {
124                   name "AGMERLTR1" ,
125                   accession "M11391" } } ,
126               descr {
127                 title "African green monkey endogenous retroviral 5' LTR,
128  segment 1 of 2." ,
129                 genbank {
130                   source "African green monkey DNA." ,
131                   keywords {
132                     "" } ,
133                   origin "145 bp upstream of HindIII site." } } ,
134               inst {
135                 repr raw ,
136                 mol dna ,
137                 length 612 ,
138                 topology linear ,
139                 strand ds ,
140                 seq-data
141                   ncbi2na 'F28B8032944007C807CC87C807C887C807C887C807C887C807C
142 C87C807C887C8874807C809F200944529DC0915950E14AE94DC0915950E14AE94DC09159541B53
143 BA735004545403D5A0740480042D620316E6AF405070D22C2115E74A5305E750D37E65D09FEE2F
144 DEEBFF97F301EDEC7293DAAD7BA507DA1328572667243037759EE1F5BAD0BADDD9861479528283
145 7001CAF713FAE47E96A0D69'H } } ,
146             seq {
147               id {
148                 giim {
149                   id 3 } ,
150                 genbank {
151                   name "AGMERLTR2" ,
152                   accession "M11390" } } ,
153               descr {
154                 title "African green monkey endogenous retroviral 3' LTR,
155  segment 2 of 2." ,
156                 genbank {
157                   source "African green monkey DNA." ,
158                   keywords {
159                     "" } ,
160                   origin "131 bp upstream of HindIII site." } } ,
161               inst {
162                 repr raw ,
163                 mol dna ,
164                 length 550 ,
165                 topology linear ,
166                 strand ds ,
167                 seq-data
168                   ncbi2na '00228A81E00CA51001F201F321F201F221F201F221F201F221F
169 201F221D201F2027C8025114A7702456543852BA537024565506D4EE9CD401151500F5681D0120
170 010B5880C5466BD0141C348B084579D294C179D434DF99742FFB8BF7BAFFE5FCC07B7B1CA4F6AB
171 5EE941F284CA15C999C90C0DDD67B87D6EB42EB77663855E54A0A0DC0072BD713C120'H } } } } } } ,
172     set {
173       level 1 ,
174       class nuc-prot ,
175       date
176         str "15-JUN-1988" ,
177       descr {
178         title "African green monkey BSC-1 cell growth inhibitor, and
179  translated products" ,
180         comment "Draft entry and computer-readable sequence for [Proc. Natl.
181  Acad. Sci. U.S.A. 85, 79-82 (1988)] kindly provided by S.Hanks, 03-DEC-1987." ,
182         pub {
183           pub {
184             muid 88124824 ,
185             article {
186               title {
187                 name "Amino acid sequence of the BSC-1 cell growth inhibitor
188  (polyergin) deduced from the nucleotide sequence of the cDNA" } ,
189               authors {
190                 names
191                   str {
192                     "Hanks,S." ,
193                     "Armour,R." ,
194                     "Baldwin,J.H." ,
195                     "Maldonado,F." ,
196                     "Spiess,J." ,
197                     "Holley,R.W." } } ,
198               from
199                 journal {
200                   title {
201                     name "Proc. Natl. Acad. Sci. U.S.A." } ,
202                   imp {
203                     date
204                       std {
205                         year 1988 } ,
206                     volume "85" ,
207                     pages "79-82" } } } } } ,
208         org {
209           taxname "Cercopithecus aethiops" } } ,
210       seq-set {
211         seq {
212           id {
213             giim {
214               id 5 } ,
215             genbank {
216               name "AGMGIBSC1" ,
217               accession "J03585" } } ,
218           descr {
219             title "African green monkey BSC-1 cell growth inhibitor, complete
220  cds." ,
221             genbank {
222               source "African green monkey kidney epithelium, cDNA to mRNA." ,
223               keywords {
224                 "BSC-1 cell growth inhibitor" ,
225                 "cartilage-inducing factor B" ,
226                 "polyergin" ,
227                 "transforming growth factor type b2" } ,
228               origin "Unreported." ,
229               date "15-JUN-1988" } } ,
230           inst {
231             repr raw ,
232             mol rna ,
233             length 1585 ,
234             topology linear ,
235             strand ss ,
236             seq-data
237               ncbi2na 'FFFC0A0F424231BFF73EA4F8723EFE402ED93400401004040004004
238 1DD7E3731FE20FBE7F7FFFFDF787F00107FFF517FF000E471EEE7899FFF8D7937AD1AD99D25EDC
239 5E4911D8CE852F4E64228D8A6359A9235E2427827452D55208735E256282D5568AE3F537104914
240 A87E7528829896889A597989988A2618A2C719428AFC4032139657DF55D600E5356547F71215C7
241 D20FBDAFE1B7490E8820E7D43FAE0A48BD22DFDBF920D402522E5E041A3E27B348F742D4087C13
242 7505499C4D84902FB80108920A60E9FD7D8EC1E39EF4E0E9F4530212817A8FC0309F11ED5E791F
243 FB14DC30F134D50300B820F20908FE4ACF8E917513314BAE34801CC0B51CA00004BA821544DD79
244 C3BCF95D7121F8B441214169A0826E7FA39A5CF9FC80EE4A30F9E5C6D67F13E3F422A372AE80E8
245 C460540A310E507DEE7A24E56CFCE8BD211D24492AD789F330C53035209379F75F9E6ED5087C81
246 77053DDC713E90045423E049FDC338FB02DF90392701F7E802E908D00F10E38E30E38E18610E38
247 E7EC14801308897EBDB49BC0000FF8029AC40'H } ,
248           annot {
249             {
250               data
251                 ftable {
252                   {
253                     data
254                       rna {
255                         type mRNA } ,
256                     location
257                       whole
258                         giim {
259                           id 5 } ,
260                     qual {
261                       {
262                         qual "note" ,
263                         val "polyergin mRNA" } } } ,
264                   {
265                     data
266                       imp {
267                         key "mat_peptide" } ,
268                     location
269                       int {
270                         from 1105 ,
271                         to 1440 ,
272                         id
273                           giim {
274                             id 5 } } ,
275                     qual {
276                       {
277                         qual "note" ,
278                         val "polyergin" } } } } } } } ,
279         seq {
280           id {
281             giim {
282               id 6 } } ,
283           descr {
284             title "polyergin precursor" ,
285             method concept-trans } ,
286           inst {
287             repr raw ,
288             mol aa ,
289             length 414 ,
290             seq-data
291               iupacaa "MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPE
292 DYPEPEEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPPTFYRPYFRIVRFD
293 VSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWL
294 HHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSY
295 RLESQQTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLY
296 NTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS" } } } ,
297       annot {
298         {
299           data
300             ftable {
301               {
302                 data
303                   cdregion {
304                     frame one ,
305                     code {
306                       id 1 } } ,
307                 product
308                   whole
309                     giim {
310                       id 6 } ,
311                 location
312                   int {
313                     from 199 ,
314                     to 1443 ,
315                     id
316                       giim {
317                         id 5 } } ,
318                 qual {
319                   {
320                     qual "note" ,
321                     val "polyergin precursor" } } } } } } } ,
322     seq {
323       id {
324         giim {
325           id 7 } ,
326         genbank {
327           name "AGMKPNRSA" ,
328           accession "J00337" } } ,
329       descr {
330         title "african green monkey kpni family interspersed repeat; ls1." ,
331         genbank {
332           source "african green monkey liver cell dna." ,
333           keywords {
334             "repetitive sequence" } ,
335           date "05-DEC-1983" } ,
336         org {
337           taxname "Cercopithecus aethiops" } ,
338         pub {
339           pub {
340             muid 83247399 ,
341             article {
342               title {
343                 name "kpn i family of long interspersed repeated dna sequences
344  in primates: polymorphism of family members and evidence for transcription" } ,
345               authors {
346                 names
347                   str {
348                     "Lerman,M.I." ,
349                     "Thayer,R.E." ,
350                     "Singer,M.F." } } ,
351               from
352                 journal {
353                   title {
354                     name "Proc. Natl. Acad. Sci. U.S.A." } ,
355                   imp {
356                     date
357                       std {
358                         year 1983 } ,
359                     volume "80" ,
360                     pages "3966-3970" } } } } } } ,
361       inst {
362         repr raw ,
363         mol dna ,
364         length 1784 ,
365         topology linear ,
366         strand ds ,
367         seq-data
368           ncbi4na '8821211884281211444A118111181228144118121128812124441248411
369 441228288211441411284211122128488211441118114141441212111121184411112218882184
370 282184418144114118211818848412118442218188122211142118881814188811841818822218
371 211428822148412888288212141188141111142412888111888218181411221111114142284848
372 144211412812228144281111411211148844144218218428122841288211148181281211442812
373 148112211112142184481284181221111214181814122118411121411214142228214111811212
374 218121828121122182141828881121112284121111121142118444411144188222828881181118
375 448428444411128442814281818821411142141112814122228882821212288184211111481188
376 211418441881114128811184811112221111221811111222814114111228144211812218821441
377 448144218444211141288218412812112122111112118842112111142211118841211184841828
378 118211128111442882142121421111811128182182142484112444211288121111844414111188
379 888421142812221828412111448281181822141182812114411288111888121141111121122221
380 821111144444218182421821111144144211144181841121412128828211114111121888184211
381 221121412121841111111428248282844821281414111842111821111221211841418122182821
382 212214881414844841881881111142214411211214184284424144284844141118444118428828
383 121284884484441181811188148821122188184411482148481421888412221421122221882284
384 448181812221111418818111821884812818411412121842121248184888188421421281888121
385 188421114188844112211122111842221881184181412844181114111184844212181818122184
386 411811818421422181111114118414882184822888421444121844184114284411122182188282
387 142111284421214411214111122111212282184882821282181148444118841421184141121218
388 441212144411444118182111212844482284881144448844444211444411441414218814412121
389 811281184218484441888111482814184121444841844484214211122122184421248481818481
390 848112111228421248828421218481822214142881114811111111111111118428411111118841
391 18111428820'H } } } }

source navigation ]   [ diff markup ]   [ identifier search ]   [ freetext search ]   [ file search ]  

This page was automatically generated by the LXR engine.
Visit the LXR main site for more information.