|
NCBI Home IEB Home C Toolkit docs C++ Toolkit source browser C Toolkit source browser (2) |
NCBI C Toolkit Cross ReferenceC/demo/bioseq.set |
source navigation diff markup identifier search freetext search file search |
1 Bioseq-set ::= {
2 level 0 ,
3 class genbank ,
4 release "66.0" ,
5 date
6 str "Apr 30, 1991 11:19 AM" ,
7 descr {
8 title "GenBank release 66.0 converted to ASN.1" } ,
9 seq-set {
10 seq {
11 id {
12 giim {
13 id 1 } ,
14 genbank {
15 name "AGMAPHAAA" ,
16 accession "M26844" } } ,
17 descr {
18 title "African green monkey alpha-DNA." ,
19 genbank {
20 source "African green monkey DNA." ,
21 keywords {
22 "alpha DNA" ,
23 "alphoid repetitive sequence" } ,
24 date "15-DEC-1989" } ,
25 org {
26 taxname "Cercopithecus aethiops" } ,
27 pub {
28 pub {
29 muid 84259347 ,
30 article {
31 title {
32 name "A protein binds to a satellite DNA repeat at three
33 specific sites that would be brought into mutual proximity by DNA folding in
34 the nucleosome" } ,
35 authors {
36 names
37 str {
38 "Strauss,F." ,
39 "Varshavsky,A." } } ,
40 from
41 journal {
42 title {
43 name "Cell" } ,
44 imp {
45 date
46 std {
47 year 1984 } ,
48 volume "37" ,
49 pages "889-901" } } } } } } ,
50 inst {
51 repr raw ,
52 mol dna ,
53 length 208 ,
54 topology linear ,
55 strand ds ,
56 seq-data
57 ncbi2na '0F74EFE127CD36309FDE201EF7BBDEF0F4DD212F137F57E0425FD9C29EF
58 7EE83E902A33FA055322A73AE00080CDF57D007A0209F00'H } } ,
59 set {
60 level 1 ,
61 class segset ,
62 date
63 str "30-SEP-1988" ,
64 descr {
65 title "African green monkey endogenous retroviral 5' LTR, segment 1 of
66 2." ,
67 pub {
68 pub {
69 muid 85295965 ,
70 article {
71 title {
72 name "Nucleotide sequence analysis and enhancer function of
73 long terminal repeats associated with an endogenous African green monkey
74 retroviral DNA" } ,
75 authors {
76 names
77 str {
78 "Kessel,M." ,
79 "Khan,A.S." } } ,
80 from
81 journal {
82 title {
83 name "Mol. Cell. Biol." } ,
84 imp {
85 date
86 std {
87 year 1985 } ,
88 volume "5" ,
89 pages "1335-1342" } } } } } ,
90 org {
91 taxname "Cercopithecus aethiops" } } ,
92 seq-set {
93 seq {
94 id {
95 giim {
96 id 4 } } ,
97 descr {
98 title "African green monkey endogenous retroviral 5' LTR, segment
99 1 of 2." } ,
100 inst {
101 repr seg ,
102 mol dna ,
103 length 1162 ,
104 fuzz
105 lim gt ,
106 ext
107 seg {
108 whole
109 giim {
110 id 2 } ,
111 null NULL ,
112 whole
113 giim {
114 id 3 } } } } ,
115 set {
116 level 3 ,
117 class parts ,
118 seq-set {
119 seq {
120 id {
121 giim {
122 id 2 } ,
123 genbank {
124 name "AGMERLTR1" ,
125 accession "M11391" } } ,
126 descr {
127 title "African green monkey endogenous retroviral 5' LTR,
128 segment 1 of 2." ,
129 genbank {
130 source "African green monkey DNA." ,
131 keywords {
132 "" } ,
133 origin "145 bp upstream of HindIII site." } } ,
134 inst {
135 repr raw ,
136 mol dna ,
137 length 612 ,
138 topology linear ,
139 strand ds ,
140 seq-data
141 ncbi2na 'F28B8032944007C807CC87C807C887C807C887C807C887C807C
142 C87C807C887C8874807C809F200944529DC0915950E14AE94DC0915950E14AE94DC09159541B53
143 BA735004545403D5A0740480042D620316E6AF405070D22C2115E74A5305E750D37E65D09FEE2F
144 DEEBFF97F301EDEC7293DAAD7BA507DA1328572667243037759EE1F5BAD0BADDD9861479528283
145 7001CAF713FAE47E96A0D69'H } } ,
146 seq {
147 id {
148 giim {
149 id 3 } ,
150 genbank {
151 name "AGMERLTR2" ,
152 accession "M11390" } } ,
153 descr {
154 title "African green monkey endogenous retroviral 3' LTR,
155 segment 2 of 2." ,
156 genbank {
157 source "African green monkey DNA." ,
158 keywords {
159 "" } ,
160 origin "131 bp upstream of HindIII site." } } ,
161 inst {
162 repr raw ,
163 mol dna ,
164 length 550 ,
165 topology linear ,
166 strand ds ,
167 seq-data
168 ncbi2na '00228A81E00CA51001F201F321F201F221F201F221F201F221F
169 201F221D201F2027C8025114A7702456543852BA537024565506D4EE9CD401151500F5681D0120
170 010B5880C5466BD0141C348B084579D294C179D434DF99742FFB8BF7BAFFE5FCC07B7B1CA4F6AB
171 5EE941F284CA15C999C90C0DDD67B87D6EB42EB77663855E54A0A0DC0072BD713C120'H } } } } } } ,
172 set {
173 level 1 ,
174 class nuc-prot ,
175 date
176 str "15-JUN-1988" ,
177 descr {
178 title "African green monkey BSC-1 cell growth inhibitor, and
179 translated products" ,
180 comment "Draft entry and computer-readable sequence for [Proc. Natl.
181 Acad. Sci. U.S.A. 85, 79-82 (1988)] kindly provided by S.Hanks, 03-DEC-1987." ,
182 pub {
183 pub {
184 muid 88124824 ,
185 article {
186 title {
187 name "Amino acid sequence of the BSC-1 cell growth inhibitor
188 (polyergin) deduced from the nucleotide sequence of the cDNA" } ,
189 authors {
190 names
191 str {
192 "Hanks,S." ,
193 "Armour,R." ,
194 "Baldwin,J.H." ,
195 "Maldonado,F." ,
196 "Spiess,J." ,
197 "Holley,R.W." } } ,
198 from
199 journal {
200 title {
201 name "Proc. Natl. Acad. Sci. U.S.A." } ,
202 imp {
203 date
204 std {
205 year 1988 } ,
206 volume "85" ,
207 pages "79-82" } } } } } ,
208 org {
209 taxname "Cercopithecus aethiops" } } ,
210 seq-set {
211 seq {
212 id {
213 giim {
214 id 5 } ,
215 genbank {
216 name "AGMGIBSC1" ,
217 accession "J03585" } } ,
218 descr {
219 title "African green monkey BSC-1 cell growth inhibitor, complete
220 cds." ,
221 genbank {
222 source "African green monkey kidney epithelium, cDNA to mRNA." ,
223 keywords {
224 "BSC-1 cell growth inhibitor" ,
225 "cartilage-inducing factor B" ,
226 "polyergin" ,
227 "transforming growth factor type b2" } ,
228 origin "Unreported." ,
229 date "15-JUN-1988" } } ,
230 inst {
231 repr raw ,
232 mol rna ,
233 length 1585 ,
234 topology linear ,
235 strand ss ,
236 seq-data
237 ncbi2na 'FFFC0A0F424231BFF73EA4F8723EFE402ED93400401004040004004
238 1DD7E3731FE20FBE7F7FFFFDF787F00107FFF517FF000E471EEE7899FFF8D7937AD1AD99D25EDC
239 5E4911D8CE852F4E64228D8A6359A9235E2427827452D55208735E256282D5568AE3F537104914
240 A87E7528829896889A597989988A2618A2C719428AFC4032139657DF55D600E5356547F71215C7
241 D20FBDAFE1B7490E8820E7D43FAE0A48BD22DFDBF920D402522E5E041A3E27B348F742D4087C13
242 7505499C4D84902FB80108920A60E9FD7D8EC1E39EF4E0E9F4530212817A8FC0309F11ED5E791F
243 FB14DC30F134D50300B820F20908FE4ACF8E917513314BAE34801CC0B51CA00004BA821544DD79
244 C3BCF95D7121F8B441214169A0826E7FA39A5CF9FC80EE4A30F9E5C6D67F13E3F422A372AE80E8
245 C460540A310E507DEE7A24E56CFCE8BD211D24492AD789F330C53035209379F75F9E6ED5087C81
246 77053DDC713E90045423E049FDC338FB02DF90392701F7E802E908D00F10E38E30E38E18610E38
247 E7EC14801308897EBDB49BC0000FF8029AC40'H } ,
248 annot {
249 {
250 data
251 ftable {
252 {
253 data
254 rna {
255 type mRNA } ,
256 location
257 whole
258 giim {
259 id 5 } ,
260 qual {
261 {
262 qual "note" ,
263 val "polyergin mRNA" } } } ,
264 {
265 data
266 imp {
267 key "mat_peptide" } ,
268 location
269 int {
270 from 1105 ,
271 to 1440 ,
272 id
273 giim {
274 id 5 } } ,
275 qual {
276 {
277 qual "note" ,
278 val "polyergin" } } } } } } } ,
279 seq {
280 id {
281 giim {
282 id 6 } } ,
283 descr {
284 title "polyergin precursor" ,
285 method concept-trans } ,
286 inst {
287 repr raw ,
288 mol aa ,
289 length 414 ,
290 seq-data
291 iupacaa "MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPE
292 DYPEPEEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPPTFYRPYFRIVRFD
293 VSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWL
294 HHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSY
295 RLESQQTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLY
296 NTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS" } } } ,
297 annot {
298 {
299 data
300 ftable {
301 {
302 data
303 cdregion {
304 frame one ,
305 code {
306 id 1 } } ,
307 product
308 whole
309 giim {
310 id 6 } ,
311 location
312 int {
313 from 199 ,
314 to 1443 ,
315 id
316 giim {
317 id 5 } } ,
318 qual {
319 {
320 qual "note" ,
321 val "polyergin precursor" } } } } } } } ,
322 seq {
323 id {
324 giim {
325 id 7 } ,
326 genbank {
327 name "AGMKPNRSA" ,
328 accession "J00337" } } ,
329 descr {
330 title "african green monkey kpni family interspersed repeat; ls1." ,
331 genbank {
332 source "african green monkey liver cell dna." ,
333 keywords {
334 "repetitive sequence" } ,
335 date "05-DEC-1983" } ,
336 org {
337 taxname "Cercopithecus aethiops" } ,
338 pub {
339 pub {
340 muid 83247399 ,
341 article {
342 title {
343 name "kpn i family of long interspersed repeated dna sequences
344 in primates: polymorphism of family members and evidence for transcription" } ,
345 authors {
346 names
347 str {
348 "Lerman,M.I." ,
349 "Thayer,R.E." ,
350 "Singer,M.F." } } ,
351 from
352 journal {
353 title {
354 name "Proc. Natl. Acad. Sci. U.S.A." } ,
355 imp {
356 date
357 std {
358 year 1983 } ,
359 volume "80" ,
360 pages "3966-3970" } } } } } } ,
361 inst {
362 repr raw ,
363 mol dna ,
364 length 1784 ,
365 topology linear ,
366 strand ds ,
367 seq-data
368 ncbi4na '8821211884281211444A118111181228144118121128812124441248411
369 441228288211441411284211122128488211441118114141441212111121184411112218882184
370 282184418144114118211818848412118442218188122211142118881814188811841818822218
371 211428822148412888288212141188141111142412888111888218181411221111114142284848
372 144211412812228144281111411211148844144218218428122841288211148181281211442812
373 148112211112142184481284181221111214181814122118411121411214142228214111811212
374 218121828121122182141828881121112284121111121142118444411144188222828881181118
375 448428444411128442814281818821411142141112814122228882821212288184211111481188
376 211418441881114128811184811112221111221811111222814114111228144211812218821441
377 448144218444211141288218412812112122111112118842112111142211118841211184841828
378 118211128111442882142121421111811128182182142484112444211288121111844414111188
379 888421142812221828412111448281181822141182812114411288111888121141111121122221
380 821111144444218182421821111144144211144181841121412128828211114111121888184211
381 221121412121841111111428248282844821281414111842111821111221211841418122182821
382 212214881414844841881881111142214411211214184284424144284844141118444118428828
383 121284884484441181811188148821122188184411482148481421888412221421122221882284
384 448181812221111418818111821884812818411412121842121248184888188421421281888121
385 188421114188844112211122111842221881184181412844181114111184844212181818122184
386 411811818421422181111114118414882184822888421444121844184114284411122182188282
387 142111284421214411214111122111212282184882821282181148444118841421184141121218
388 441212144411444118182111212844482284881144448844444211444411441414218814412121
389 811281184218484441888111482814184121444841844484214211122122184421248481818481
390 848112111228421248828421218481822214142881114811111111111111118428411111118841
391 18111428820'H } } } }
|
This page was automatically generated by the
LXR engine.
Visit the LXR main site for more information. |