Similarity Searching
Course Home Modules Schedule Exercises Comments Credits
Slide 1 Previous Next Slide List

BLAST 2 Sequences Translation Products

>Translation of practice sequence
MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAID
FSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPRAPLGPGPCRSPPAQ
ARARLGRRRRARLAVARAGGRVRTDRGELGGRRAAHPAHVAGAAAQQPQADPRARPRPGE
ERRQEGPGPRQPRVPAAARAQQHRRAQEPRQGQAAQPGDAAEVGGAVG

>Translation of NM_005195
TSAGARKGGGAGPSEVTASLGRRARPDAAMSAALFSLDGPARGAPWPAEPAPFYEPGRAG
KPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHK
AGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAA
AGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDK
AKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR*R
AAGAGETQQRPIPQTRRPGAERALPWRSQSRRVPAAVSWDIGAQRSYSLDLPPLNCERS*
TCLFSLKLFL*W*LFLHLTPVDAAKVHL*KEKKPDFSDKPFVL*IRGKD*ACSLFYINFY
SICKNKAAFEI

Similarity Searching
Slide 1 Previous Next Slide List
Revised 07/22/2005