BLAST module of the MLA course on Introduction to Molecular Biology Information Resources


Course Home	Modules	Schedule	Exercises	Comments	Credits

User Question:
Identify Gene Involved In Sleep Disorder

Our research group has obtained the following sequence data from patients with disturbed sleeping patterns:


Nucleotide sequence:  gggtgaacag ccgcacggga gtaggtacgc acctgacctc gctggcactg
ccgggcaagg cagagggtgt ggcgtcgctc accagccagt gcagctacag cagcaccatc gtccatgtgg
gagacaagaa gccgcagccg gagttagaga tggtggaaga tgctgcgagt gggccagaat

AA translation:  RTGVGTHLTSLALPGKAEGVASLTSQCSYSSTIVHVGDKKP

What gene might this be?

Answer

BLAST		Revised 11/05/2007

User Question:Identify Gene Involved In Sleep Disorder

User Question:
Identify Gene Involved In Sleep Disorder