Problem Summary:
Compare a gene sequence from normal versus diseased patients |
| Sample User Question |
 |
| |
How does the sequence obtained from patients with sleep
disturbances differ from the normal sequence?
Patient sequence: RTGVGTHLTSLALPGKAEGVASLTSQCSYSSTIVHVGDKKP
Normal sequence: RTGVGTHLTSLALPGKAESVASLTSQCSYSSTIVHVGDKKP
|
|
|
| Analysis/Comments |
|
|
By determining which amino acids are different in normal versus diseased patients, the researchers can contribute to the understanding of circadian biology. The BLAST 2 Sequences Program (Pairwise BLAST) permits a comparison of two sequences to each other (not to the database).
|
| Flow Chart |
|
- BLAST 2 Sequences, Sequence 1 - Enter patient sequence into first query box.
- BLAST 2 Sequences, Sequence 2 - Enter normal sequence into second query box.
- Choose blastp (Program) - Use pulldown menu to choose protein blast (blastp) because amino acids are being compared.
- Click Align
|
| Additional Notes |
|
|
The results page shows a difference in one amino acid between the two sequences.
|
|
