NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22034.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22034.1 Public Mus musculus 7 Ins2 16 104 75 CCDS HistoryNCBI Gene:16334Re-query CCDS DB by CCDS ID:22034.1Re-query CCDS DB by GeneID:16334

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 22034.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000000220 ENSMUSP00000000220 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000000220Link to Ensembl Protein Viewer:ENSMUSP00000000220Re-query CCDS DB by Nucleotide ID:ENSMUST00000000220Re-query CCDS DB by Protein ID:ENSMUSP00000000220
Original member Current member EBI,WTSI ENSMUST00000105932 ENSMUSP00000101552 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000105932Link to Ensembl Protein Viewer:ENSMUSP00000101552Re-query CCDS DB by Nucleotide ID:ENSMUST00000105932Re-query CCDS DB by Protein ID:ENSMUSP00000101552
Original member Current member EBI,WTSI ENSMUST00000105933 ENSMUSP00000101553 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000105933Link to Ensembl Protein Viewer:ENSMUSP00000101553Re-query CCDS DB by Nucleotide ID:ENSMUST00000105933Re-query CCDS DB by Protein ID:ENSMUSP00000101553
Original member Current member EBI,WTSI ENSMUST00000105934 ENSMUSP00000101554 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000105934Link to Ensembl Protein Viewer:ENSMUSP00000101554Re-query CCDS DB by Nucleotide ID:ENSMUST00000105934Re-query CCDS DB by Protein ID:ENSMUSP00000101554
Original member Current member EBI,WTSI OTTMUST00000045247 OTTMUSP00000020351 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000045247Link to Vega Protein Viewer:OTTMUSP00000020351Re-query CCDS DB by Nucleotide ID:OTTMUST00000045247Re-query CCDS DB by Protein ID:OTTMUSP00000020351
Original member Current member EBI,WTSI OTTMUST00000045248 OTTMUSP00000020352 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000045248Link to Vega Protein Viewer:OTTMUSP00000020352Re-query CCDS DB by Nucleotide ID:OTTMUST00000045248Re-query CCDS DB by Protein ID:OTTMUSP00000020352
Original member Current member EBI,WTSI OTTMUST00000045251 OTTMUSP00000020355 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000045251Link to Vega Protein Viewer:OTTMUSP00000020355Re-query CCDS DB by Nucleotide ID:OTTMUST00000045251Re-query CCDS DB by Protein ID:OTTMUSP00000020355
Original member Current member EBI,WTSI OTTMUST00000045252 OTTMUSP00000020356 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000045252Link to Vega Protein Viewer:OTTMUSP00000020356Re-query CCDS DB by Nucleotide ID:OTTMUST00000045252Re-query CCDS DB by Protein ID:OTTMUSP00000020356
Original member Current member NCBI NM_001185083.1 NP_001172012.1 Accepted alive Link to Nucleotide Sequence:NM_001185083.1Link to Protein Sequence:NP_001172012.1Re-query CCDS DB by Nucleotide ID:NM_001185083Re-query CCDS DB by Protein ID:NP_001172012Link to BLink:NP_001172012.1
Original member Current member NCBI NM_001185084.1 NP_001172013.1 Accepted alive Link to Nucleotide Sequence:NM_001185084.1Link to Protein Sequence:NP_001172013.1Re-query CCDS DB by Nucleotide ID:NM_001185084Re-query CCDS DB by Protein ID:NP_001172013Link to BLink:NP_001172013.1
Original member Current member NCBI NM_008387.4 NP_032413.1 Accepted alive Link to Nucleotide Sequence:NM_008387.4Link to Protein Sequence:NP_032413.1Re-query CCDS DB by Nucleotide ID:NM_008387Re-query CCDS DB by Protein ID:NP_032413Link to BLink:NP_032413.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001172012.1 110 P01326 110 100% 0 0
NP_001172013.1 110 P01326 110 100% 0 0
NP_032413.1 110 P01326 110 100% 0 0

Chromosomal Locations for CCDS 22034.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

Chromosome Start Stop Links
7 142678713 142678858 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 142679347 142679533 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (333 nt):
ATGGCCCTGTGGATGCGCTTCCTGCCCCTGCTGGCCCTGCTCTTCCTCTGGGAGTCCCACCCCACCCAGG
CT
TTTGTCAAGCAGCACCTTTGTGGTTCCCACCTGGTGGAGGCTCTCTACCTGGTGTGTGGGGAGCGTGG
C
TTCTTCTACACACCCATGTCCCGCCGTGAAGTGGAGGACCCACAAGTGGCACAACTGGAGCTGGGTGGA
GGC
CCGGGAGCAGGTGACCTTCAGACCTTGGCACTGGAGGTGGCCCAGCAGAAGCGTGGCATTGTAGATC
AG
TGCTGCACCAGCATCTGCTCCCTCTACCAGCTGGAGAACTACTGCAACTAG


Translation (110 aa):
MALWMRFLPLLALLFLWESHPTQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVEDPQVAQLELGG
G
PGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser