NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3463.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3463.1 Public Homo sapiens 4 PHOX2B 18 107 79 CCDS HistoryNCBI Gene:8929Re-query CCDS DB by CCDS ID:3463.1Re-query CCDS DB by GeneID:8929See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 3463.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000226382 ENSP00000226382 Accepted alive Link to Ensembl Transcript Viewer:ENST00000226382Link to Ensembl Protein Viewer:ENSP00000226382Re-query CCDS DB by Nucleotide ID:ENST00000226382Re-query CCDS DB by Protein ID:ENSP00000226382
Original member Current member EBI,WTSI OTTHUMT00000216832 OTTHUMP00000125223 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000216832Link to Vega Protein Viewer:OTTHUMP00000125223Re-query CCDS DB by Nucleotide ID:OTTHUMT00000216832Re-query CCDS DB by Protein ID:OTTHUMP00000125223
Original member Current member NCBI NM_003924.3 NP_003915.2 Accepted alive Link to Nucleotide Sequence:NM_003924.3Link to Protein Sequence:NP_003915.2Re-query CCDS DB by Nucleotide ID:NM_003924Re-query CCDS DB by Protein ID:NP_003915Link to BLink:NP_003915.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003915.2 314 Q99453 314 100% 0 0

Chromosomal Locations for CCDS 3463.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 41745807 41746322 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 41747349 41747536 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 41748370 41748610 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (945 nt):
ATGTATAAAATGGAATATTCTTACCTCAATTCCTCTGCCTACGAGTCCTGTATGGCTGGGATGGACACCT
CG
AGCCTGGCTTCAGCCTATGCTGACTTCAGTTCCTGCAGCCAGGCCAGTGGCTTCCAGTATAACCCGAT
A
AGGACCACTTTTGGGGCCACGTCCGGCTGCCCTTCCCTCACGCCGGGATCCTGCAGCCTGGGCACCCTC
AGG
GACCACCAGAGCAGTCCGTACGCCGCAGTTCCTTACAAACTCTTCACGGACCACGGCGGCCTCAACG
AG
AAGCGCAAGCAGCGGCGCATCCGCACCACTTTCACCAGTGCCCAGCTCAAAGAGCTGGAAAGGGTCTT
C
GCGGAGACTCACTACCCCGACATCTACACTCGGGAGGAGCTGGCCCTGAAGATCGACCTCACAGAGGCG
CGA
GTCCAGGTGTGGTTCCAGAACCGCCGCGCCAAGTTTCGCAAGCAGGAGCGCGCAGCGGCAGCCGCAG
CG
GCCGCGGCCAAGAACGGCTCCTCGGGCAAAAAGTCTGACTCTTCCAGGGACGACGAGAGCAAAGAGGC
C
AAGAGCACTGACCCGGACAGCACTGGGGGCCCAGGTCCCAATCCCAACCCCACCCCCAGCTGCGGGGCG
AAT
GGAGGCGGCGGCGGCGGGCCCAGCCCGGCTGGAGCTCCGGGGGCGGCGGGGCCCGGGGGCCCGGGAG
GC
GAACCCGGCAAGGGCGGCGCAGCAGCAGCGGCGGCGGCCGCGGCAGCGGCGGCGGCGGCAGCGGCAGC
G
GCGGCAGCTGGAGGCCTGGCTGCGGCTGGGGGCCCTGGACAAGGCTGGGCTCCCGGCCCCGGCCCCATC
ACC
TCCATCCCGGATTCGCTTGGGGGTCCCTTCGCCAGCGTCCTATCTTCGCTCCAAAGACCCAACGGTG
CC
AAAGCCGCCTTAGTGAAGAGCAGTATGTTCTGA


Translation (314 aa):
MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTL
R
DHQSSPYAA
VPYKLFTDHGGLNEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEA
R
VQ
VWFQNRRAKFRKQERAAAAAAAAAKNGSSGKKSDSSRDDESKEAKSTDPDSTGGPGPNPNPTPSCGA
N
GGGGGGPSPAGAPGAAGPGGPGGEPGKGGAAAAAAAAAAAAAAAAAAAAGGLAAAGGPGQGWAPGPGPI
T
SIPDSLGGPFASVLSSLQRPNGAKAALVKSSMF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser