NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS33283.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
33283.1 Public Homo sapiens 2 GLI2 15 105 74 CCDS HistoryNCBI Gene:2736Re-query CCDS DB by CCDS ID:33283.1Re-query CCDS DB by GeneID:2736

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Sequence IDs included in CCDS 33283.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000361492 ENSP00000354586 Accepted alive Link to Ensembl Transcript Viewer:ENST00000361492Link to Ensembl Protein Viewer:ENSP00000354586Re-query CCDS DB by Nucleotide ID:ENST00000361492Re-query CCDS DB by Protein ID:ENSP00000354586
Original member Current member EBI,WTSI ENST00000452319 ENSP00000390436 Accepted alive Link to Ensembl Transcript Viewer:ENST00000452319Link to Ensembl Protein Viewer:ENSP00000390436Re-query CCDS DB by Nucleotide ID:ENST00000452319Re-query CCDS DB by Protein ID:ENSP00000390436
Original member Current member EBI,WTSI OTTHUMT00000332293 OTTHUMP00000204359 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000332293Link to Vega Protein Viewer:OTTHUMP00000204359Re-query CCDS DB by Nucleotide ID:OTTHUMT00000332293Re-query CCDS DB by Protein ID:OTTHUMP00000204359
Original member Current member NCBI NM_005270.4 NP_005261.2 Accepted alive Link to Nucleotide Sequence:NM_005270.4Link to Protein Sequence:NP_005261.2Re-query CCDS DB by Nucleotide ID:NM_005270Re-query CCDS DB by Protein ID:NP_005261Link to BLink:NP_005261.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005261.2 1586 P10070-5 1586 100% 0 0

Chromosomal Locations for CCDS 33283.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '+' strand of Chromosome 2 (NC_000002.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 121554897 121555044 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 121684937 121685042 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 121708819 121709021 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 121712821 121713006 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 121726290 121726491 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 121727969 121728182 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 121729517 121729639 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 121732500 121732685 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 121736010 121736159 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 121740292 121740456 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 121742047 121742319 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 121743854 121744190 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 121745784 121748251 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4761 nt):
ATGGAGACGTCTGCCTCAGCCACTGCCTCCGAGAAGCAAGAAGCCAAAAGTGGGATCCTGGAGGCCGCTG
GC
TTCCCCGACCCGGGTAAAAAGGCCTCTCCTTTGGTGGTGGCTGCAGCGGCAGCAGCAGCGGTAGCTGC
C
CAAGGAGTGCCGCAGCATCTCTTGCCACCATTCCATGCGCCCCTACCGATTGACATGCGACACCAGGAA
GGA
AGGTACCATTACGAGCCTCATTCTGTCCACGGTGTGCACGGGCCCCCTGCCCTCAGCGGCAGCCCTG
TC
ATCTCTGACATCTCCTTGATCCGGCTTTCCCCGCACCCGGCTGGCCCTGGGGAGTCCCCCTTCAACGC
C
CCCCACCCGTACGTGAACCCCCACATGGAGCACTACCTCCGTTCTGTGCACAGCAGCCCCACGCTCTCC
ATG
ATCTCTGCAGCCAGGGGCCTCAGCCCCGCTGATGTGGCCCAGGAGCACCTTAAGGAGAGGGGACTGT
TT
GGCCTTCCTGCTCCAGGCACCACCCCCTCAGACTATTACCACCAGATGACCCTCGTGGCAGGCCACCC
C
GCGCCCTACGGGGACCTGCTGATGCAGAGCGGGGGCGCTGCCAGCGCACCCCATCTCCACGACTACCTC
AAC
CCCGTGGACGTGTCCCGTTTCTCCAGCCCGCGGGTGACGCCCCGCCTGAGCCGCAAGCGGGCGCTGT
CC
ATCTCCCCACTCTCAGACGCCAGCCTGGACCTGCAGCGGATGATCCGCACCTCACCCAACTCGCTAGT
G
GCCTACATCAACAACTCCCGAAGCAGCTCGGCGGCCAGCGGTTCCTACGGGCATCTGTCAGCGGGTGCC
CTC
AGCCCAGCCTTCACCTTCCCCCACCCCATCAACCCCGTGGCCTACCAGCAGATTCTGAGCCAGCAGA
GG
GGTCTGGGGTCAGCCTTTGGACACACACCACCCCTGATCCAGCCCTCACCCACCTTCCTGGCCCAGCA
G
CCCATGGCCCTCACCTCCATCAATGCCACGCCCACCCAGCTCAGCAGCAGCAGCAACTGTCTGAGTGAC
ACC
AACCAGAACAAGCAGAGCAGTGAGTCGGCCGTCAGCAGCACCGTCAACCCTGTCGCCATTCACAAGC
GC
AGCAAGGTCAAGACCGAGCCTGAGGGCCTGCGGCCGGCCTCCCCTCTGGCGCTGACGCAGGGCCAGGT
G
TCTGGACACGGCTCATGTGGGTGTGCCCTTCCCCTCTCCCAGGAGCAGCTGGCTGACCTCAAGGAAGAT
CTG
GACAGGGATGACTGTAAGCAGGAGGCTGAGGTGGTCATCTATGAGACCAACTGCCACTGGGAAGACT
GC
ACCAAGGAGTACGACACCCAGGAGCAGCTGGTGCATCACATCAACAACGAGCACATCCACGGGGAGAA
G
AAGGAGTTTGTGTGCCGCTGGCAGGCCTGCACGCGGGAGCAGAAGCCCTTCAAGGCGCAGTACATGCTG
GTG
GTGCACATGCGGCGACACACGGGCGAGAAGCCCCACAAGTGCACGTTCGAGGGCTGCTCGAAGGCCT
AC
TCCCGCCTGGAGAACCTGAAGACACACCTGCGGTCCCACACCGGGGAGAAGCCATATGTGTGTGAGCA
C
GAGGGCTGCAACAAAGCCTTCTCCAACGCCTCGGACCGCGCCAAGCACCAGAATCGCACCCACTCCAAC
GAG
AAACCCTACATCTGCAAGATCCCAGGCTGCACCAAGAGATACACAGACCCCAGCTCTCTCCGGAAGC
AT
GTGAAAACGGTCCACGGCCCAGATGCCCACGTCACCAAGAAGCAGCGCAATGACGTGCACCTCCGCAC
A
CCGCTGCTCAAAGAGAATGGGGACAGTGAGGCCGGCACGGAGCCTGGCGGCCCAGAGAGCACCGAGGCC
AGC
AGCACCAGCCAGGCCGTGGAGGACTGCCTGCACGTCAGAGCCATCAAGACCGAGAGCTCCGGGCTGT
GT
CAGTCCAGCCCCGGGGCCCAGTCGTCCTGCAGCAGCGAGCCCTCTCCTCTGGGCAGTGCCCCCAACAA
T
GACAGTGGCGTGGAGATGCCGGGGACGGGGCCCGGGAGCCTGGGAGACCTGACGGCACTGGATGACACA
CCC
CCAGGGGCCGACACCTCAGCCCTGGCTGCCCCCTCCGCTGGTGGCCTCCAGCTGCGCAAACACATGA
CC
ACCATGCACCGGTTCGAGCAGCTCAAGAAGGAGAAGCTCAAGTCACTCAAGGATTCCTGCTCATGGGC
C
GGGCCGACTCCACACACGCGGAACACCAAGCTGCCTCCCCTCCCGGGAAGTGGCTCCATCCTGGAAAAC
TTC
AGTGGCAGTGGGGGCGGCGGGCCCGCGGGGCTGCTGCCGAACCCGCGGCTGTCGGAGCTGTCCGCGA
GC
GAGGTGACCATGCTGAGCCAGCTGCAGGAGCGCCGCGACAGCTCCACCAGCACGGTCAGCTCGGCCTA
C
ACCGTGAGCCGCCGCTCCTCCGGCATCTCCCCCTACTTCTCCAGCCGCCGCTCCAGCGAGGCCTCGCCC
CTG
GGCGCCGGCCGCCCGCACAACGCGAGCTCCGCTGACTCCTACGACCCCATCTCCACGGACGCGTCGC
GG
CGCTCGAGCGAGGCCAGCCAGTGCAGCGGCGGCTCCGGGCTGCTCAACCTCACGCCGGCGCAGCAGTA
C
AGCCTGCGGGCCAAGTACGCGGCAGCCACTGGCGGCCCCCCGCCCACTCCGCTGCCGGGCCTGGAGCGC
ATG
AGCCTGCGGACCAGGCTGGCGCTGCTGGACGCGCCCGAGCGCACGCTGCCCGCCGGCTGCCCACGCC
CA
CTGGGGCCGCGGCGTGGCAGCGACGGGCCGACCTATGGCCACGGCCACGCGGGGGCTGCGCCCGCCTT
C
CCCCACGAGGCTCCAGGCGGCGGAGCCAGGCGGGCCAGCGACCCTGTGCGGCGGCCCGATGCCCTGTCC
CTG
CCGCGGGTGCAGCGCTTCCACAGCACCCACAACGTGAACCCCGGCCCGCTGCCGCCCTGTGCCGACA
GG
CGAGGCCTCCGCCTGCAGAGCCACCCGAGCACCGACGGCGGCCTGGCCCGCGGCGCCTACTCGCCCCG
G
CCGCCTAGCATCAGCGAGAACGTGGCGATGGAGGCCGTGGCGGCAGGAGTGGACGGCGCGGGGCCCGAG
GCC
GACCTGGGGCTGCCGGAGGACGACCTGGTGCTTCCAGACGACGTGGTGCAGTACATCAAGGCGCACG
CC
AGTGGCGCTCTGGACGAGGGCACCGGGCAGGTGTATCCCACGGAAAGCACTGGCTTCTCTGACAACCC
C
AGACTACCCAGCCCGGGGCTGCACGGCCAGCGCAGGATGGTGGCTGCGGACTCCAACGTGGGCCCCTCC
GCC
CCTATGCTGGGAGGATGCCAGTTAGGCTTTGGGGCGCCCTCCAGCCTGAACAAAAATAACATGCCTG
TG
CAGTGGAATGAGGTGAGCTCCGGCACCGTAGACGCCCTGGCCAGCCAGGTGAAGCCTCCACCCTTTCC
T
CAGGGCAACCTGGCGGTGGTGCAGCAGAAGCCTGCCTTTGGCCAGTACCCGGGCTACAGTCCGCAAGGC
CTA
CAGGCTAGCCCTGGGGGCCTGGACAGCACGCAGCCACACCTGCAGCCCCGCAGCGGAGCCCCCTCCC
AG
GGCATCCCCAGGGTAAACTACATGCAGCAGCTGCGACAGCCAGTGGCAGGCAGCCAGTGTCCTGGCAT
G
ACTACCACTATGAGCCCCCATGCCTGCTATGGCCAAGTCCACCCCCAGCTGAGCCCCAGCACCATCAGT
GGG
GCCCTCAACCAGTTCCCCCAATCCTGCAGCAACATGCCAGCCAAGCCAGGGCATCTGGGGCACCCTC
AG
CAGACAGAAGTGGCACCTGACCCCACCACGATGGGCAATCGCCACAGGGAACTTGGGGTCCCCGATTC
A
GCCCTGGCTGGAGTGCCACCACCTCACCCAGTCCAGAGCTACCCACAGCAGAGCCATCACCTGGCAGCC
TCC
ATGAGCCAGGAGGGCTACCACCAGGTCCCCAGCCTTCTGCCTGCCCGCCAGCCTGGCTTCATGGAGC
CC
CAAACAGGCCCGATGGGGGTGGCTACAGCAGGCTTTGGCCTAGTGCAGCCCCGGCCTCCCCTCGAGCC
C
AGCCCCACTGGCCGCCACCGTGGGGTACGTGCTGTGCAGCAGCAGCTGGCCTACGCCAGGGCCACAGGC
CAT
GCCATGGCTGCCATGCCGTCCAGTCAGGAAACAGCAGAGGCTGTGCCCAAGGGAGCGATGGGCAACA
TG
GGGTCGGTGCCTCCCCAGCCGCCTCCGCAGGACGCAGGTGGGGCCCCGGACCACAGCATGCTCTACTA
C
TACGGCCAGATCCACATGTACGAACAGGATGGAGGCCTGGAGAACCTCGGGAGCTGCCAGGTCATGCGG
TCC
CAGCCACCACAGCCACAGGCCTGTCAGGACAGCATCCAGCCCCAGCCCTTGCCCTCACCAGGGGTCA
AC
CAGGTGTCCAGCACTGTGGACTCCCAGCTCCTGGAGGCCCCCCAGATTGACTTCGATGCCATCATGGA
T
GATGGCGATCACTCGAGTTTGTTCTCGGGTGCTCTGAGCCCCAGCCTCCTCCACAGCCTCTCCCAGAAC
TCC
TCCCGCCTCACCACCCCCCGAAACTCCTTGACCCTGCCCTCCATCCCCGCAGGCATCAGCAACATGG
CT
GTCGGGGACATGAGCTCCATGCTCACCAGCCTCGCCGAGGAGAGCAAGTTCCTGAACATGATGACCTA
G


Translation (1586 aa):
METSASATASEKQEAKSGILEAAGFPDPGKKASPLVVAAAAAAAVAAQGVPQHLLPPFHAPLPIDMRHQE
G
RYHYEPHSVHGVH
GPPALSGSPVISDISLIRLSPHPAGPGESPFNAPHPYVNPHMEHYLRSVHSSPTLS
M
ISAARGLSPAD
VAQEHLKERGLFGLPAPGTTPSDYYHQMTLVAGHPAPYGDLLMQSGGAASAPHLHDYL
N
PVD
VSRFSSPRVTPRLSRKRALSISPLSDASLDLQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGA
L
SPAFTFPHPINPVAYQQILSQQRGLGSAFGHTPPLIQPSPTFLAQQPMALTSINATPTQLSSSSNCLSD
T
NQ
NKQSSESAVSSTVNPVAIHKRSKVKTEPEGLRPASPLALTQGQVSGHGSCGCALPLSQEQLADLKED
L
DRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVH
HINNEHIHGEKKEFVCRWQACTREQKPFKAQYML
V
VHMRRHTGEKPHKCT
FEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSN
E
KPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEA
S
STSQAVEDCLHVRAIKTESSG
LCQSSPGAQSSCSSEPSPLGSAPNNDSGVEMPGTGPGSLGDLTALDDT
P
PGADTSALAAPSAGGLQLRKHMTTMHRFEQLKKEKLKSLKDSCSWAGPTPHTRNTKLPPLPGS
GSILEN
F
SGSGGGGPAGLLPNPRLSELSASEVTMLSQLQERRDSSTSTVSSAYTVSRRSSGISPYFSSRRSSEASP
L
GAGRPHNASSADSYDPISTDASRRSSEASQCSGGSGLLNLTPAQQYSLRAKYAAATGGPPPTPLPGLER
M
SLRTRLALLDAPERTLPAGCPRPLGPRRGSDGPTYGHGHAGAAPAFPHEAPGGGARRASDPVRRPDALS
L
PRVQRFHSTHNVNPGPLPPCADRRGLRLQSHPSTDGGLARGAYSPRPPSISENVAMEAVAAGVDGAGPE
A
DLGLPEDDLVLPDDVVQYIKAHASGALDEGTGQVYPTESTGFSDNPRLPSPGLHGQRRMVAADSNVGPS
A
PMLGGCQLGFGAPSSLNKNNMPVQWNEVSSGTVDALASQVKPPPFPQGNLAVVQQKPAFGQYPGYSPQG
L
QASPGGLDSTQPHLQPRSGAPSQGIPRVNYMQQLRQPVAGSQCPGMTTTMSPHACYGQVHPQLSPSTIS
G
ALNQFPQSCSNMPAKPGHLGHPQQTEVAPDPTTMGNRHRELGVPDSALAGVPPPHPVQSYPQQSHHLAA
S
MSQEGYHQVPSLLPARQPGFMEPQTGPMGVATAGFGLVQPRPPLEPSPTGRHRGVRAVQQQLAYARATG
H
AMAAMPSSQETAEAVPKGAMGNMGSVPPQPPPQDAGGAPDHSMLYYYGQIHMYEQDGGLENLGSCQVMR
S
QPPQPQACQDSIQPQPLPSPGVNQVSSTVDSQLLEAPQIDFDAIMDDGDHSSLFSGALSPSLLHSLSQN
S
SRLTTPRNSLTLPSIPAGISNMAVGDMSSMLTSLAEESKFLNMMT




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser