NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS9994.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9994.1 Public Homo sapiens 14 AKT1 17 106 76 CCDS HistoryNCBI Gene:207Re-query CCDS DB by CCDS ID:9994.1Re-query CCDS DB by GeneID:207See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 9994.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000349310 ENSP00000270202 Accepted alive Link to Ensembl Transcript Viewer:ENST00000349310Link to Ensembl Protein Viewer:ENSP00000270202Re-query CCDS DB by Nucleotide ID:ENST00000349310Re-query CCDS DB by Protein ID:ENSP00000270202
Original member Current member EBI,WTSI ENST00000407796 ENSP00000384293 Accepted alive Link to Ensembl Transcript Viewer:ENST00000407796Link to Ensembl Protein Viewer:ENSP00000384293Re-query CCDS DB by Nucleotide ID:ENST00000407796Re-query CCDS DB by Protein ID:ENSP00000384293
Original member Current member EBI,WTSI ENST00000402615 ENSP00000385326 Accepted alive Link to Ensembl Transcript Viewer:ENST00000402615Link to Ensembl Protein Viewer:ENSP00000385326Re-query CCDS DB by Nucleotide ID:ENST00000402615Re-query CCDS DB by Protein ID:ENSP00000385326
Original member Current member EBI,WTSI ENST00000555528 ENSP00000450688 Accepted alive Link to Ensembl Transcript Viewer:ENST00000555528Link to Ensembl Protein Viewer:ENSP00000450688Re-query CCDS DB by Nucleotide ID:ENST00000555528Re-query CCDS DB by Protein ID:ENSP00000450688
Original member Current member EBI,WTSI ENST00000554848 ENSP00000451166 Accepted alive Link to Ensembl Transcript Viewer:ENST00000554848Link to Ensembl Protein Viewer:ENSP00000451166Re-query CCDS DB by Nucleotide ID:ENST00000554848Re-query CCDS DB by Protein ID:ENSP00000451166
Original member Current member EBI,WTSI ENST00000554581 ENSP00000451828 Accepted alive Link to Ensembl Transcript Viewer:ENST00000554581Link to Ensembl Protein Viewer:ENSP00000451828Re-query CCDS DB by Nucleotide ID:ENST00000554581Re-query CCDS DB by Protein ID:ENSP00000451828
Original member Current member EBI,WTSI OTTHUMT00000410379 OTTHUMP00000244411 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000410379Link to Vega Protein Viewer:OTTHUMP00000244411Re-query CCDS DB by Nucleotide ID:OTTHUMT00000410379Re-query CCDS DB by Protein ID:OTTHUMP00000244411
Original member Current member EBI,WTSI OTTHUMT00000410418 OTTHUMP00000244432 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000410418Link to Vega Protein Viewer:OTTHUMP00000244432Re-query CCDS DB by Nucleotide ID:OTTHUMT00000410418Re-query CCDS DB by Protein ID:OTTHUMP00000244432
Original member Current member EBI,WTSI OTTHUMT00000410419 OTTHUMP00000244433 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000410419Link to Vega Protein Viewer:OTTHUMP00000244433Re-query CCDS DB by Nucleotide ID:OTTHUMT00000410419Re-query CCDS DB by Protein ID:OTTHUMP00000244433
Original member Current member EBI,WTSI OTTHUMT00000410422 OTTHUMP00000244434 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000410422Link to Vega Protein Viewer:OTTHUMP00000244434Re-query CCDS DB by Nucleotide ID:OTTHUMT00000410422Re-query CCDS DB by Protein ID:OTTHUMP00000244434
Original member Current member EBI,WTSI OTTHUMT00000410423 OTTHUMP00000244435 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000410423Link to Vega Protein Viewer:OTTHUMP00000244435Re-query CCDS DB by Nucleotide ID:OTTHUMT00000410423Re-query CCDS DB by Protein ID:OTTHUMP00000244435
Original member Current member EBI,WTSI OTTHUMT00000410428 OTTHUMP00000244439 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000410428Link to Vega Protein Viewer:OTTHUMP00000244439Re-query CCDS DB by Nucleotide ID:OTTHUMT00000410428Re-query CCDS DB by Protein ID:OTTHUMP00000244439
Original member Current member NCBI NM_001014431.1 NP_001014431.1 Accepted alive Link to Nucleotide Sequence:NM_001014431.1Link to Protein Sequence:NP_001014431.1Re-query CCDS DB by Nucleotide ID:NM_001014431Re-query CCDS DB by Protein ID:NP_001014431Link to BLink:NP_001014431.1
Original member Current member NCBI NM_001014432.1 NP_001014432.1 Accepted alive Link to Nucleotide Sequence:NM_001014432.1Link to Protein Sequence:NP_001014432.1Re-query CCDS DB by Nucleotide ID:NM_001014432Re-query CCDS DB by Protein ID:NP_001014432Link to BLink:NP_001014432.1
Original member Current member NCBI NM_005163.2 NP_005154.2 Accepted alive Link to Nucleotide Sequence:NM_005163.2Link to Protein Sequence:NP_005154.2Re-query CCDS DB by Nucleotide ID:NM_005163Re-query CCDS DB by Protein ID:NP_005154Link to BLink:NP_005154.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001014431.1 480 P31749-1 480 100% 0 0
NP_001014432.1 480 P31749-1 480 100% 0 0
NP_005154.2 480 P31749-1 480 100% 0 0

Chromosomal Locations for CCDS 9994.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 104770341 104770420 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 104770745 104770847 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 104772365 104772452 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 104772878 104773092 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 104773251 104773379 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 104773455 104773580 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 104773912 104773980 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 104774938 104775003 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 104775076 104775207 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 104775652 104775799 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 104776659 104776770 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 104780088 104780216 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 104792598 104792643 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1443 nt):
ATGAGCGACGTGGCTATTGTGAAGGAGGGTTGGCTGCACAAACGAGGGGAGTACATCAAGACCTGGCGGC
CA
CGCTACTTCCTCCTCAAGAATGATGGCACCTTCATTGGCTACAAGGAGCGGCCGCAGGATGTGGACCA
A
CGTGAGGCTCCCCTCAACAACTTCTCTGTGGCGCAGTGCCAGCTGATGAAGACGGAGCGGCCCCGGCCC
AAC
ACCTTCATCATCCGCTGCCTGCAGTGGACCACTGTCATCGAACGCACCTTCCATGTGGAGACTCCTG
AG
GAGCGGGAGGAGTGGACAACCGCCATCCAGACTGTGGCTGACGGCCTCAAGAAGCAGGAGGAGGAGGA
G
ATGGACTTCCGGTCGGGCTCACCCAGTGACAACTCAGGGGCTGAAGAGATGGAGGTGTCCCTGGCCAAG
CCC
AAGCACCGCGTGACCATGAACGAGTTTGAGTACCTGAAGCTGCTGGGCAAGGGCACTTTCGGCAAGG
TG
ATCCTGGTGAAGGAGAAGGCCACAGGCCGCTACTACGCCATGAAGATCCTCAAGAAGGAAGTCATCGT
G
GCCAAGGACGAGGTGGCCCACACACTCACCGAGAACCGCGTCCTGCAGAACTCCAGGCACCCCTTCCTC
ACA
GCCCTGAAGTACTCTTTCCAGACCCACGACCGCCTCTGCTTTGTCATGGAGTACGCCAACGGGGGCG
AG
CTGTTCTTCCACCTGTCCCGGGAGCGTGTGTTCTCCGAGGACCGGGCCCGCTTCTATGGCGCTGAGAT
T
GTGTCAGCCCTGGACTACCTGCACTCGGAGAAGAACGTGGTGTACCGGGACCTCAAGCTGGAGAACCTC
ATG
CTGGACAAGGACGGGCACATTAAGATCACAGACTTCGGGCTGTGCAAGGAGGGGATCAAGGACGGTG
CC
ACCATGAAGACCTTTTGCGGCACACCTGAGTACCTGGCCCCCGAGGTGCTGGAGGACAATGACTACGG
C
CGTGCAGTGGACTGGTGGGGGCTGGGCGTGGTCATGTACGAGATGATGTGCGGTCGCCTGCCCTTCTAC
AAC
CAGGACCATGAGAAGCTTTTTGAGCTCATCCTCATGGAGGAGATCCGCTTCCCGCGCACGCTTGGTC
CC
GAGGCCAAGTCCTTGCTTTCAGGGCTGCTCAAGAAGGACCCCAAGCAGAGGCTTGGCGGGGGCTCCGA
G
GACGCCAAGGAGATCATGCAGCATCGCTTCTTTGCCGGTATCGTGTGGCAGCACGTGTACGAGAAGAAG
CTC
AGCCCACCCTTCAAGCCCCAGGTCACGTCGGAGACTGACACCAGGTATTTTGATGAGGAGTTCACGG
CC
CAGATGATCACCATCACACCACCTGACCAAGATGACAGCATGGAGTGTGTGGACAGCGAGCGCAGGCC
C
CACTTCCCCCAGTTCTCCTACTCGGCCAGCGGCACGGCCTGA


Translation (480 aa):
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRP
N
TFIIRCLQWTTVIERTFHVETPEE
REEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAK
P
KHRV
TMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFL
T
ALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENL
M
LDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPE
VLEDNDYGRAVDWWGLGVVMYEMMCGRLPFY
N
QDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQ
RLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
L
SPPFKPQVTSETDTRYFDEEFTAQMITITPPDQ
DDSMECVDSERRPHFPQFSYSASGTA



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser