NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10113.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10113.1 Public Homo sapiens 15 B2M 17 106 76 CCDS HistoryNCBI Gene:567Re-query CCDS DB by CCDS ID:10113.1Re-query CCDS DB by GeneID:567

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 10113.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000558401 ENSP00000452780 Accepted alive Link to Ensembl Transcript Viewer:ENST00000558401Link to Ensembl Protein Viewer:ENSP00000452780Re-query CCDS DB by Nucleotide ID:ENST00000558401Re-query CCDS DB by Protein ID:ENSP00000452780
Original member Current member EBI,WTSI ENST00000561424 ENSP00000453191 Accepted alive Link to Ensembl Transcript Viewer:ENST00000561424Link to Ensembl Protein Viewer:ENSP00000453191Re-query CCDS DB by Nucleotide ID:ENST00000561424Re-query CCDS DB by Protein ID:ENSP00000453191
Original member Current member EBI,WTSI ENST00000559916 ENSP00000453350 Accepted alive Link to Ensembl Transcript Viewer:ENST00000559916Link to Ensembl Protein Viewer:ENSP00000453350Re-query CCDS DB by Nucleotide ID:ENST00000559916Re-query CCDS DB by Protein ID:ENSP00000453350
Original member Current member EBI,WTSI OTTHUMT00000254007 OTTHUMP00000161912 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000254007Link to Vega Protein Viewer:OTTHUMP00000161912Re-query CCDS DB by Nucleotide ID:OTTHUMT00000254007Re-query CCDS DB by Protein ID:OTTHUMP00000161912
Original member Current member EBI,WTSI OTTHUMT00000415956 OTTHUMP00000247201 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000415956Link to Vega Protein Viewer:OTTHUMP00000247201Re-query CCDS DB by Nucleotide ID:OTTHUMT00000415956Re-query CCDS DB by Protein ID:OTTHUMP00000247201
Original member Current member EBI,WTSI OTTHUMT00000415957 OTTHUMP00000247202 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000415957Link to Vega Protein Viewer:OTTHUMP00000247202Re-query CCDS DB by Nucleotide ID:OTTHUMT00000415957Re-query CCDS DB by Protein ID:OTTHUMP00000247202
Original member Current member NCBI NM_004048.2 NP_004039.1 Accepted alive Link to Nucleotide Sequence:NM_004048.2Link to Protein Sequence:NP_004039.1Re-query CCDS DB by Nucleotide ID:NM_004048Re-query CCDS DB by Protein ID:NP_004039Link to BLink:NP_004039.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_004039.1 119 P61769 119 100% 0 0

Chromosomal Locations for CCDS 10113.1

Assembly GRCh38 (GCF_000001405.26)

On '+' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

Chromosome Start Stop Links
15 44711547 44711613 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 44715423 44715701 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 44716329 44716342 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (360 nt):
ATGTCTCGCTCCGTGGCCTTAGCTGTGCTCGCGCTACTCTCTCTTTCTGGCCTGGAGGCTATCCAGCGTA
CT
CCAAAGATTCAGGTTTACTCACGTCATCCAGCAGAGAATGGAAAGTCAAATTTCCTGAATTGCTATGT
G
TCTGGGTTTCATCCATCCGACATTGAAGTTGACTTACTGAAGAATGGAGAGAGAATTGAAAAAGTGGAG
CAT
TCAGACTTGTCTTTCAGCAAGGACTGGTCTTTCTATCTCTTGTACTACACTGAATTCACCCCCACTG
AA
AAAGATGAGTATGCCTGCCGTGTGAACCATGTGACTTTGTCACAGCCCAAGATAGTTAAGTGGGATCG
A
GACATGTAA


Translation (119 aa):
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVE
H
SDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKW
DRDM



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser