NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS42972.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
42972.1 Public Homo sapiens 21 COL18A1 18 107 79 CCDS HistoryNCBI Gene:80781Re-query CCDS DB by CCDS ID:42972.1Re-query CCDS DB by GeneID:80781See the combined annotation on chromosome 21 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Sequence IDs included in CCDS 42972.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000355480 ENSP00000347665 Accepted alive Link to Ensembl Transcript Viewer:ENST00000355480Link to Ensembl Protein Viewer:ENSP00000347665Re-query CCDS DB by Nucleotide ID:ENST00000355480Re-query CCDS DB by Protein ID:ENSP00000347665
Original member Current member EBI,WTSI OTTHUMT00000206827 OTTHUMP00000115472 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000206827Link to Vega Protein Viewer:OTTHUMP00000115472Re-query CCDS DB by Nucleotide ID:OTTHUMT00000206827Re-query CCDS DB by Protein ID:OTTHUMP00000115472
Original member Current member NCBI NM_030582.3 NP_085059.2 Accepted alive Link to Nucleotide Sequence:NM_030582.3Link to Protein Sequence:NP_085059.2Re-query CCDS DB by Nucleotide ID:NM_030582Re-query CCDS DB by Protein ID:NP_085059Link to BLink:NP_085059.2

Chromosomal Locations for CCDS 42972.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '+' strand of Chromosome 21 (NC_000021.9)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 21Link to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21See the combined annotation on chromosome 21 in Sequence Viewer

Chromosome Start Stop Links
21 45455531 45456176 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45468242 45468786 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45473895 45473981 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45475476 45475535 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45476351 45476480 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45477411 45477487 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45477750 45477965 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45478327 45478353 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45479902 45479964 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45480070 45480156 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45480467 45480520 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45480700 45480858 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45481963 45482025 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45482795 45482821 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45486861 45486992 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45487447 45487509 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45488418 45488444 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45489486 45489521 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45490275 45490346 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45490836 45490871 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45491225 45491314 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45492535 45492564 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45492687 45492713 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45493163 45493225 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45493501 45493575 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45494545 45494571 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45494862 45494915 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45495358 45495432 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45496500 45496568 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45497050 45497092 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45497599 45497661 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45504011 45504054 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45504416 45504556 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45505134 45505278 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45505358 45505431 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45505838 45505966 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45507561 45507593 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45509356 45509601 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45510064 45510261 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45511111 45511226 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21
21 45512188 45512398 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21Link to Vega Genome Browser on chromosome 21

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4560 nt):
ATGGCTCCCTACCCCTGTGGCTGCCACATCCTGCTGCTGCTCTTCTGCTGCCTGGCGGCTGCCCGGGCCA
AC
CTGCTGAACCTGAACTGGCTTTGGTTCAATAATGAGGACACCAGCCATGCAGCTACCACGATCCCTGA
G
CCCCAGGGGCCCCTGCCTGTGCAGCCCACAGCAGATACCACCACACACGTGACCCCCCGGAATGGTTCC
ACA
GAGCCAGCGACAGCCCCTGGCAGCCCTGAGCCACCCTCAGAGCTGCTGGAAGATGGCCAGGACACCC
CC
ACTTCTGCCGAGAGCCCGGACGCGCCAGAGGAGAACATTGCCGGTGTCGGAGCCGAGATCCTGAACGT
G
GCCAAAGGCATCCGGAGCTTCGTCCAGCTGTGGAATGACACTGTCCCCACTGAGAGCTTGGCCAGGGCG
GAA
ACCCTGGTCCTGGAGACTCCTGTGGGCCCCCTTGCCCTCGCTGGGCCTTCCAGCACCCCCCAGGAGA
AT
GGGACCACTCTCTGGCCCAGCCGTGGCATTCCTAGCTCTCCGGGCGCCCACACAACCGAGGCTGGCAC
C
TTGCCTGCACCCACCCCATCGCCTCCCTCCCTGGGCAGGCCCTGGGCACCACTCACGGGGCCCTCAGTG
CCA
CCACCATCTTCAGAGCGCATCAGCGAGGAGGTGGGGCTGCTGCAGCTCCTTGGGGACCCCCCGCCCC
AG
CAGGTCACCCAGACGGATGACCCCGACGTCGGGCTGGCCTACGTCTTTGGGCCAGATGCCAACAGTGG
C
CAAGTGGCCCGGTACCACTTCCCCAGCCTCTTCTTCCGTGACTTCTCACTGCTGTTCCACATCCGGCCA
GCC
ACAGAGGGCCCAGGGGTGCTGTTCGCCATCACGGACTCGGCGCAGGCCATGGTCTTGCTGGGCGTGA
AG
CTCTCTGGGGTGCAGGACGGGCACCAGGACATCTCCCTGCTCTACACAGAACCAGGTGCAGGCCAGAC
C
CACACAGCCGCCAGCTTCCGGCTCCCCGCCTTCGTCGGCCAGTGGACACACTTAGCCCTCAGTGTGGCA
GGT
GGCTTTGTGGCCCTCTACGTGGACTGTGAGGAGTTCCAGAGAATGCCGCTTGCTCGGTCCTCACGGG
GC
CTGGAGCTGGAGCCTGGCGCCGGGCTCTTCGTGGCTCAGGCGGGGGGAGCGGACCCTGACAAGTTCCA
G
GGGGTGATCGCTGAGCTGAAGGTGCGCAGGGACCCCCAGGTGAGCCCCATGCACTGCCTGGACGAGGAA
GGC
GATGACTCAGATGGGGCATCCGGAGACTCTGGCAGCGGGCTCGGGGACGCCCGGGAGCTTCTCAGGG
AG
GAGACGGGCGCGGCCCTAAAACCCAGGCTCCCCGCGCCACCCCCCGTCACCACGCCACCCTTGGCTGG
A
GGCAGCAGCACGGAAGATTCCAGAAGTGAAGAAGTCGAGGAGCAGACCACGGTGGCTTCGTTAGGAGCT
CAG
ACACTTCCTGGCTCAGATTCTGTCTCCACGTGGGACGGGAGTGTCCGGACCCCTGGGGGCCGCGTGA
AA
GAGGGCGGCCTGAAGGGGCAGAAAGGGGAGCCAGGTGTTCCGGGCCCACCTGGCCGGGCAGGCCCCCC
A
GGATCCCCATGCCTACCTGGTCCCCCGGGTCTCCCGTGCCCAGTGAGTCCCCTGGGTCCTGCAGGCCCA
GCG
TTGCAAACTGTCCCCGGACCACAAGGACCCCCAGGGCCTCCGGGGAGGGACGGCACCCCTGGAAGGG
AC
GGCGAGCCGGGCGACCCCGGTGAAGACGGAAAGCCGGGCGACACCGGGCCACAAGGCTTCCCCGGGAC
T
CCAGGGGACGTAGGTCCCAAGGGCGACAAGGGAGACCCTGGGGTTGGAGAGAGAGGGCCCCCAGGACCC
CAA
GGGCCTCCAGGGCCCCCAGGACCCTCCTTCAGACACGACAAGCTGACCTTCATTGACATGGAGGGAT
CT
GGCTTCGGGGGCGATCTGGAGGCCCTGCGGGGTCCTCGAGGCTTCCCTGGACCTCCCGGACCCCCCGG
T
GTCCCAGGCCTGCCCGGCGAGCCAGGCCGCTTTGGGGTGAACAGCTCCGACGTCCCAGGACCCGCCGGC
CTT
CCTGGTGTGCCTGGGCGCGAGGGTCCCCCCGGGTTTCCTGGCCTCCCGGGACCCCCAGGCCCTCCGG
GA
AGAGAGGGGCCCCCAGGAAGGACTGGGCAGAAAGGCAGCCTGGGTGAAGCAGGCGCCCCAGGACATAA
G
GGGAGCAAGGGAGCCCCCGGTCCTGCTGGTGCTCGTGGGGAGAGCGGCCTGGCAGGAGCCCCCGGACCT
GCT
GGACCACCAGGCCCCCCTGGGCCCCCTGGGCCCCCAGGACCAGGACTCCCCGCTGGATTTGATGACA
TG
GAAGGCTCCGGGGGGCCCTTCTGGTCAACAGCCCGAAGCGCTGATGGGCCACAGGGACCTCCCGGCCT
G
CCGGGACTTAAGGGGGATCCTGGCGTGCCTGGGCTGCCGGGGGCGAAGGGAGAAGTTGGAGCAGATGGA
GTC
CCCGGGTTCCCCGGCCTCCCTGGCAGAGAGGGCATTGCTGGGCCCCAGGGGCCAAAGGGAGACAGAG
GC
AGCCGGGGAGAAAAGGGAGATCCAGGGAAGGACGGAGTCGGGCAGCCGGGCCTCCCTGGCCCCCCCGG
A
CCCCCGGGACCTGTGGTCTACGTGTCGGAGCAGGACGGATCCGTCCTGAGCGTGCCGGGACCTGAGGGC
CGG
CCGGGTTTCGCAGGCTTTCCCGGACCTGCAGGACCCAAGGGCAACCTGGGCTCTAAGGGCGAACGAG
GC
TCCCCGGGACCCAAGGGTGAGAAGGGTGAACCGGGCAGCATCTTCAGCCCCGACGGCGGTGCCCTGGG
C
CCTGCCCAGAAAGGAGCCAAGGGAGAGCCGGGCTTCCGAGGACCCCCGGGTCCATACGGACGGCCGGGG
TAC
AAGGGAGAGATTGGCTTTCCTGGACGGCCGGGTCGCCCCGGGATGAACGGATTGAAAGGAGAGAAAG
GG
GAGCCGGGAGATGCCAGCCTTGGATTTGGCATGAGGGGAATGCCCGGCCCCCCAGGACCTCCAGGGCC
C
CCAGGCCCTCCAGGGACTCCTGTTTACGACAGCAATGTGTTTGCTGAGTCCAGCCGCCCCGGGCCTCCA
GGA
TTGCCAGGGAATCAGGGCCCTCCAGGACCCAAGGGCGCCAAAGGAGAAGTGGGCCCCCCCGGACCAC
CA
GGGCAGTTTCCGTTTGACTTTCTTCAGTTGGAGGCTGAAATGAAGGGGGAGAAGGGAGACCGAGGTGA
T
GCAGGACAGAAAGGCGAAAGGGGGGAGCCCGGGGGCGGCGGTTTCTTCGGCTCCAGCCTGCCCGGCCCC
CCC
GGCCCCCCAGGCCCCCCAGGCCCACGTGGCTACCCTGGGATTCCAGGTCCCAAGGGAGAGAGCATCC
GG
GGCCAGCCCGGCCCACCTGGACCTCAGGGACCCCCCGGCATCGGCTACGAGGGGCGCCAGGGCCCTCC
C
GGCCCCCCAGGCCCCCCAGGGCCCCCTTCATTTCCTGGCCCTCACAGGCAGACTATCAGCGTTCCCGGC
CCT
CCGGGCCCCCCTGGGCCCCCTGGGCCCCCTGGAACCATGGGCGCCTCCTCAGGGGTGAGGCTCTGGG
CT
ACACGCCAGGCCATGCTGGGCCAGGTGCACGAGGTTCCCGAGGGCTGGCTCATCTTCGTGGCCGAGCA
G
GAGGAGCTCTACGTCCGCGTGCAGAACGGGTTCCGGAAGGTCCAGCTGGAGGCCCGGACACCACTCCCA
CGA
GGGACGGACAATGAAGTGGCCGCCTTGCAGCCCCCCGTGGTGCAGCTGCACGACAGCAACCCCTACC
CG
CGGCGGGAGCACCCCCACCCCACCGCGCGGCCCTGGCGGGCAGATGACATCCTGGCCAGCCCCCCTCG
C
CTGCCCGAGCCCCAGCCCTACCCCGGAGCCCCGCACCACAGCTCCTACGTGCACCTGCGGCCGGCGCGA
CCC
ACAAGCCCACCCGCCCACAGCCACCGCGACTTCCAGCCGGTGCTCCACCTGGTTGCGCTCAACAGCC
CC
CTGTCAGGCGGCATGCGGGGCATCCGCGGGGCCGACTTCCAGTGCTTCCAGCAGGCGCGGGCCGTGGG
G
CTGGCGGGCACCTTCCGCGCCTTCCTGTCCTCGCGCCTGCAGGACCTGTACAGCATCGTGCGCCGTGCC
GAC
CGCGCAGCCGTGCCCATCGTCAACCTCAAGGACGAGCTGCTGTTTCCCAGCTGGGAGGCTCTGTTCT
CA
GGCTCTGAGGGTCCGCTGAAGCCCGGGGCACGCATCTTCTCCTTTGACGGCAAGGACGTCCTGAGGCA
C
CCCACCTGGCCCCAGAAGAGCGTGTGGCATGGCTCGGACCCCAACGGGCGCAGGCTGACCGAGAGCTAC
TGT
GAGACGTGGCGGACGGAGGCTCCCTCGGCCACGGGCCAGGCCTCCTCGCTGCTGGGGGGCAGGCTCC
TG
GGGCAGAGTGCCGCGAGCTGCCATCACGCCTACATCGTGCTCTGCATTGAGAACAGCTTCATGACTGC
C
TCCAAGTAG


Translation (1519 aa):
MAPYPCGCHILLLLFCCLAAARANLLNLNWLWFNNEDTSHAATTIPEPQGPLPVQPTADTTTHVTPRNGS
T
EPATAPGSPEPPSELLEDGQDTPTSAESPDAPEENIAGVGAEILNVAKGIRSFVQLWNDTVPTESLARA
E
TLVLETPVGPLALAGPSSTPQENGTTLWPSRGIPSSPGAHTTEAGTLPAPTPSPPSLGRPWAPLTGPSV
P
PPSS
ERISEEVGLLQLLGDPPPQQVTQTDDPDVGLAYVFGPDANSGQVARYHFPSLFFRDFSLLFHIRP
A
TEGPGVLFAITDSAQAMVLLGVKLSGVQDGHQDISLLYTEPGAGQTHTAASFRLPAFVGQWTHLALSVA
G
GFVALYVDCEEFQRMPLARSSRGLELEPGAGLFVAQAGGADPDKFQ
GVIAELKVRRDPQVSPMHCLDEE
G
DDSDG
ASGDSGSGLGDARELLREETGAALKPRLPAPPPVTTPPLAGGSSTEDSRSEEVEEQTTVASLGA
Q
TLPGSDSVSTWDGSVRTPGGRVKE
GGLKGQKGEPGVPGPPGRAGPPGSPCLPGPPGLPCPVSPLGPAGP
A
LQTVPGPQGPPGPPGRDGTPGRDGEP
GDPGEDGKPGDTGPQGFPGTPGDVGPKGDKGDPGVGERGPPGP
Q
GPPGPPGPSFRHDKL
TFIDMEGSGFGGDLEALRGPRGFPGPPGPPGVPGLPGEPGRFGVNSSDVPGPAG
L
PGVPGREGPPGFPGLP
GPPGPPGREGPPGRTGQKGSLGEAGAPGHKGSKGAPGPAGARGESGLAGAPGP
A
GPPGPPGPPGPPGPGLPAGF
DDMEGSGGPFWSTARSADGPQGPPGLPGLKGDPGVPGLPGAKGEVGADG
V
PGFPGLPGREGIAGPQ
GPKGDRGSRGEKGDPGKDGVGQPGLPGPPGPPGPVVYVSEQDGSVLSVPGPEG
R
PGFAGFP
GPAGPKGNLGSKGERGSPGPKGEKGEPGSIFSPDGGALGPAQKGAKGEPGFRGPPGPYGRPG
Y
KGEIGFPGRP
GRPGMNGLKGEKGEPGDASLGFGMRGMPGPPGPPGPPGPPGTPVYDSNVFAESSRPGPP
G
LP
GNQGPPGPKGAKGEVGPPGPPGQFPFDFLQLEAEMKGEKGDRGDAGQKGERGEPGGGGFFGSSLPGP
P
GPPGPPGPRGYPGIP
GPKGESIRGQPGPPGPQGPPGIGYEGRQGPPGPPGPPGPPSFPGPHRQTISVPG
P
PGPPGPPGPPGTMGASSG
VRLWATRQAMLGQVHEVPEGWLIFVAEQEELYVRVQNGFRKVQLEARTPLP
R
GT
DNEVAALQPPVVQLHDSNPYPRREHPHPTARPWRADDILASPPRLPEPQPYPGAPHHSSYVHLRPAR
P
TSPPAHSHRDFQPV
LHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRA
D
RAAVPIVNLK
DELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESY
C
ETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser