NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS5334.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5334.1 Public Homo sapiens 7 BRAT1 17 106 76 CCDS HistoryNCBI Gene:221927Re-query CCDS DB by CCDS ID:5334.1Re-query CCDS DB by GeneID:221927See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 5334.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000340611 ENSP00000339637 Accepted alive Link to Ensembl Transcript Viewer:ENST00000340611Link to Ensembl Protein Viewer:ENSP00000339637Re-query CCDS DB by Nucleotide ID:ENST00000340611Re-query CCDS DB by Protein ID:ENSP00000339637
Original member Current member EBI,WTSI OTTHUMT00000239305 OTTHUMP00000147633 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000239305Link to Vega Protein Viewer:OTTHUMP00000147633Re-query CCDS DB by Nucleotide ID:OTTHUMT00000239305Re-query CCDS DB by Protein ID:OTTHUMP00000147633
Original member Current member NCBI NM_152743.3 NP_689956.2 Accepted alive Link to Nucleotide Sequence:NM_152743.3Link to Protein Sequence:NP_689956.2Re-query CCDS DB by Nucleotide ID:NM_152743Re-query CCDS DB by Protein ID:NP_689956Link to BLink:NP_689956.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_689956.2 821 Q6PJG6-1 821 100% 0 0

Chromosomal Locations for CCDS 5334.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 2538069 2538764 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 2539179 2539351 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 2539544 2539642 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 2539786 2539888 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 2540979 2541052 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 2541298 2541484 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 2541718 2541836 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 2542120 2542211 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 2543204 2543323 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 2543590 2543962 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 2544909 2545056 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 2547324 2547478 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 2554305 2554431 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2466 nt):
ATGGACCCAGAATGCGCCCAGCTGCTCCCGGCTCTCTGTGCTGTTCTGGTAGATCCCAGGCAGCCGGTGG
CA
GATGACACCTGTTTGGAGAAGCTCCTGGACTGGTTTAAAACGGTCACTGAAGGAGAGTCCAGTGTCGT
G
CTGCTGCAGGAGCACCCCTGCCTGGTGGAGCTGCTGTCCCATGTGCTGAAAGTCCAGGACCTGAGTTCT
GGG
GTCCTCTCCTTCTCACTGCGCCTGGCAGGAACCTTCGCAGCCCAGGAAAACTGCTTCCAGTATCTTC
AG
CAGGGGGAGTTACTACCAGGGCTCTTTGGGGAGCCAGGACCCCTCGGCCGAGCAACCTGGGCCGTCCC
C
ACCGTGCGCAGCGGCTGGATCCAGGGCCTGCGCTCCCTGGCACAGCACCCCAGCGCCCTGCGCTTCCTG
GCC
GACCATGGTGCGGTCGACACCATCTTCTCCCTGCAGGGAGACTCCAGCCTGTTTGTGGCCTCGGCGG
CC
AGTCAGCTCCTGGTGCACGTCCTGGCTTTGTCCATGCGAGGTGGAGCCGAGGGGCAGCCCTGCCTGCC
G
GGGGGTGACTGGCCCGCGTGTGCCCAGAAGATCATGGATCACGTTGAAGAGTCCTTGTGCTCCGCGGCC
ACC
CCCAAGGTCACTCAGGCCCTGAACGTCCTGACCACGACCTTCGGGCGCTGCCAGAGCCCCTGGACGG
AA
GCCCTGTGGGTGCGGCTGAGTCCCCGCGTGGCCTGTCTGCTGGAGAGAGACCCCATCCCCGCCGCACA
C
TCGTTCGTGGACCTGCTTCTCTGTGTGGCTCGTTCTCCCGTGTTCAGTTCTTCCGACGGCAGCCTGTGG
GAG
ACAGTGGCGCGGGCTCTGAGCTGCCTGGGTCCCACCCACATGGGACCCCTGGCTTTGGGGATCCTGA
AG
CTCGAGCACTGTCCACAGGCACTGAGGACCCAGGCCTTCCAGGTCCTTCTCCAGCCCCTGGCCTGTGT
C
CTGAAGGCCACGGTTCAGGCCCCCGGACCCCCAGGCTTGCTGGACGGGACGGCAGACGATGCCACGACG
GTG
GACACACTCCTGGCCTCCAAGTCGTCCTGCGCCGGCCTCCTGTGCCGCACCCTGGCTCACCTGGAGG
AG
CTGCAGCCGCTGCCCCAGCGCCCTTCACCGTGGCCCCAGGCGTCTCTACTGGGGGCTACAGTGACTGT
C
CTGCGGCTCTGTGACGGCTCGGCTGCCCCTGCCTCCAGTGTGGGGGGCCACCTCTGTGGGACCCTGGCG
GGC
TGCGTCCGGGTCCAGCGAGCAGCCCTCGACTTCCTGGGGACGCTGTCACAGGGGACAGGCCCCCAGG
AG
CTGGTGACGCAGGCGCTTGCTGTCCTCCTGGAGTGCCTCGAGAGCCCCGGCTCCAGCCCCACGGTTCT
G
AAGAAGGCCTTCCAGGCCACGCTCAGGTGGCTCCTGAGCTCACCCAAGACCCCCGGCTGCTCTGATCTC
GGC
CCCCTCATCCCGCAGTTCCTCAGAGAGCTGTTCCCTGTGCTGCAGAAACGCCTGTGCCACCCCTGCT
GG
GAGGTGAGGGACTCCGCCCTCGAGTTCCTGACCCAGCTGAGCAGGCACTGGGGAGGACAGGCTGACTT
C
AGATGCGCACTCTTGGCTTCAGAGGTGCCTCAGCTGGCCCTGCAGCTCCTCCAGGACCCTGAGAGTTAT
GTC
CGAGCGAGTGCAGTGACCGCCATGGGGCAGCTGTCCAGCCAGGGCCTGCACGCCCCCACCAGCCCTG
AG
CATGCAGAGGCCCGGCAGAGCCTGTTCCTGGAGCTCCTGCACATCCTCTCCGTAGACTCGGAGGGCTT
C
CCACGGCGGGCGGTCATGCAAGTCTTCACTGAGTGGCTGCGGGACGGCCACGCCGACGCGGCCCAGGAC
ACG
GAGCAGTTCGTGGCCACTGTGCTGCAGGCGGCGAGCCGAGACCTGGACTGGGAGGTCCGCGCCCAGG
GC
CTGGAGCTGGCCCTCGTGTTCCTGGGCCAGACTTTGGGGCCGCCGCGTACCCACTGCCCCTATGCCGT
G
GCCCTACCCGAGGTGGCCCCAGCCCAGCCACTCACCGAGGCACTGAGGGCTCTCTGCCACGTGGGGCTC
TTT
GACTTCGCCTTTTGTGCCTTGTTTGACTGCGACCGCCCTGTGGCGCAGAAGTCTTGTGACCTCCTTC
TC
TTCCTGAGGGACAAGATTGCTTCCTACAGCAGCCTGCGGGAGGCCAGGGGCAGCCCCAACACTGCCTC
C
GCAGAGGCCACCCTGCCGAGGTGGCGGGCGGGTGAGCAGGCCCAGCCCCCAGGGGACCAGGAGCCTGAG
GCT
GTGCTGGCCATGCTCAGGTCCCTAGACCTGGAGGGCCTGCGGAGCACGCTGGCCGAGAGCAGCGACC
AC
GTGGAAAAGAGTCCCCAGTCCCTCCTGCAGGACATGCTGGCCACGGGAGGCTTCCTGCAGGGGGACGA
G
GCCGACTGCTACTGA


Translation (821 aa):
MDPECAQLLPALCAVLVDPRQPVADDTCLEKLLDWFKTVTEGESSVVLLQEHPCLVELLSHVLKVQDLSS
G
VLSFSLRLAGTFAAQENCFQYLQ
QGELLPGLFGEPGPLGRATWAVPTVRSGWIQGLRSLAQHPSALRFL
A
DH
GAVDTIFSLQGDSSLFVASAASQLLVHVLALSMRGGAEGQPCLPGGDWPACAQKIMDHVEESLCSAA
T
PKVTQALNVLTTTFGRCQSPWTEALWVRLSPRVACLLERDPIPAAHSFVDLLLCVA
RSPVFSSSDGSLW
E
TVARALSCLGPTHMGPLALGILKLEH
CPQALRTQAFQVLLQPLACVLKATVQAPGPPGLLDGTADDATT
V
DTLLASKSSCAGLLCRTLAHLEELQPL
PQRPSPWPQASLLGATVTVLRLCDGSAAPASSVGGHLCGTLA
G
CVRVQRAALDFLGTLSQGT
GPQELVTQALAVLLECLESPGSSPTVLKKAFQATLRWLLSSPKTPGCSDL
G
PLIPQFLR
ELFPVLQKRLCHPCWEVRDSALEFLTQLSRHWGGQADFRCALLASEVPQLALQLLQDPESY
V
RASAVTAMGQLSSQGLHAPTSPEHAEARQ
SLFLELLHILSVDSEGFPRRAVMQVFTEWLRDGHADAAQD
T
EQFVATVLQAASRDLDWEVRAQGLELALVFLGQTLGPPRTHCPYAVALPEVAPAQPLTEALRALCHVGL
F
DFAFCALFDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAGEQAQPPGDQEPE
A
VLAMLRSLDLEGLRSTLAESSDHVEKSPQSLLQDMLATGGFLQGDEADCY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser